SecReT4
Protein ID: 153948477
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3719
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4197668..4198189 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDA7FN45
KEGG IDypi:YpsIP31758_3719
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 3.4e-48, Aligned region: 27..171
Protein Sequence: 173 a.a.     [Download]
>gi|153948477|ref|YP_001402673.1| hypothetical protein YpsIP31758_3719 [Yersinia pseudotuberculosis IP 31758]
MKLLFTALLMMSAILISPINYAALTVVGDLGGESAEPYLDAVSTQPNEFSPAEKWVLPLPPTSISIAAAL
PVHTPELTPGAVSARTLNLPGIPPIFIVGDDELSRQWLSLHANKLQRIGAIGFVVNVTSLSRLQSLNTLV
PEVEMAPVSGSDLARRLQLTHYPLLITEKGLTQ
 
Nucleotide Sequence: 522 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4198189-4197668 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAAATTATTGTTCACAGCATTATTAATGATGTCTGCCATTCTCATCTCCCCGATAAATTATGCCGCAT
TGACGGTGGTTGGAGACCTCGGTGGTGAGTCGGCCGAACCTTACCTGGATGCCGTTAGTACCCAGCCTAA
CGAATTTTCACCAGCGGAAAAATGGGTGCTACCTTTGCCTCCGACATCGATATCCATTGCTGCGGCACTG
CCTGTTCATACTCCTGAACTGACTCCGGGGGCCGTTTCAGCGCGAACGCTTAATCTTCCGGGCATACCGC
CGATTTTTATTGTGGGTGATGATGAACTGTCGCGGCAGTGGCTCTCACTGCACGCCAATAAATTGCAACG
AATAGGGGCCATAGGATTTGTGGTTAATGTGACCAGCCTGTCTCGCTTGCAGAGTTTGAATACGCTGGTT
CCCGAGGTTGAAATGGCCCCGGTTTCTGGCAGTGATCTTGCCCGCCGTTTGCAACTGACGCATTACCCTT
TACTCATCACTGAGAAGGGGCTGACTCAGTAA
 Primer design