SecReT4
Protein ID: 153948703
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3701
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4176218..4177171 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDA7FN27
KEGG IDypi:YpsIP31758_3701
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.3e-92, Aligned region: 36..308
Protein Sequence: 317 a.a.     [Download]
>gi|153948703|ref|YP_001402655.1| hypothetical protein YpsIP31758_3701 [Yersinia pseudotuberculosis IP 31758]
MTLTSLRHRRLLPLILLIGSSQCMANVNTASLIISAASASCISWKVKGICYWLLCTPLGCSVKTSVKVEH
FIPEAVVSAYSGPGDNPWVEMAAVSRAASGAESGITGMLTGGGQQQMKAPGLRQQNLRYHYADAYGHPAT
SLMGGNIAGYSCRSAATPFAPYFVSALDALVWRSGLPESLYPEALIPGQRELGRQSNANMWGNIYPRSGF
VIQQDSYKSAAVVAQRVADIITRHGQLHVYHPLVGQPSPGYWPPDPVRENTGSQNHKWQRLEPQLSTACA
IFPEANGPIAQSGNYAWALWQPYSCCKRRGQTFLLHH
 
Nucleotide Sequence: 954 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4177171-4176218 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGACTCTCACGTCTCTGCGCCATCGGCGATTATTACCGCTTATTCTCCTTATCGGTAGCAGCCAGTGTA
TGGCGAACGTCAACACCGCAAGCTTGATTATCAGTGCGGCCAGCGCTTCGTGCATCAGTTGGAAAGTGAA
AGGAATCTGCTACTGGTTGCTGTGTACGCCTTTGGGTTGTTCAGTGAAAACCTCCGTCAAAGTTGAGCAT
TTTATTCCCGAAGCCGTTGTCTCTGCCTACAGCGGCCCCGGCGATAATCCCTGGGTGGAGATGGCTGCTG
TCAGCAGAGCCGCTAGTGGGGCTGAAAGCGGTATTACGGGTATGCTGACTGGCGGTGGTCAACAGCAAAT
GAAGGCACCTGGCTTACGTCAACAGAACCTGCGCTACCATTATGCAGATGCCTATGGACATCCGGCGACC
TCGCTGATGGGGGGCAATATTGCAGGCTATTCCTGCCGTTCAGCCGCCACTCCTTTTGCCCCTTATTTTG
TCAGTGCCCTCGATGCTTTGGTATGGCGCAGTGGTTTGCCTGAATCTCTCTATCCAGAAGCACTCATCCC
CGGGCAACGTGAACTGGGTCGCCAGTCAAACGCCAATATGTGGGGGAATATTTACCCTCGTAGCGGTTTT
GTTATTCAGCAGGATAGCTATAAATCCGCTGCGGTAGTCGCCCAACGGGTTGCCGATATTATTACTCGTC
ATGGTCAACTGCATGTTTATCACCCCCTGGTTGGTCAACCTTCGCCGGGCTATTGGCCGCCTGACCCGGT
TCGTGAGAATACCGGTAGCCAGAATCATAAATGGCAGCGTCTGGAGCCACAGCTCTCAACGGCCTGCGCT
ATTTTTCCAGAGGCTAACGGCCCCATTGCTCAGAGCGGTAACTATGCCTGGGCACTCTGGCAACCTTACA
GTTGCTGTAAGCGGCGTGGGCAAACCTTCCTCTTACATCACTGA
 Primer design