SecReT4
Protein ID: 153948810
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3702
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4177168..4177572 [-]
Producthypothetical protein
Component typeTfc24
UniProt IDA7FN28
KEGG IDypi:YpsIP31758_3702
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 8e-41, Aligned region: 19..131
Protein Sequence: 134 a.a.     [Download]
>gi|153948810|ref|YP_001402656.1| hypothetical protein YpsIP31758_3702 [Yersinia pseudotuberculosis IP 31758]
MIRPISYLAALCLSSGAFANRVIYTDGSYPVSVISPDIPIVYLDAPDRVQRGIFGSLPTDPVQAEKQVRK
LLASPTFKLRQQQLTAAWQGVMKAWSLGLEKYPAVVFDDQWVVYGTTDIDVATQQFTLWRETNQ
 
Nucleotide Sequence: 405 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4177572-4177168 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGATCAGACCTATCAGCTACCTGGCCGCGCTATGCTTGTCTAGTGGCGCTTTTGCCAATAGAGTTATCT
ATACCGACGGCTCTTATCCCGTATCTGTCATATCCCCCGATATCCCGATTGTTTATCTTGATGCTCCAGA
CCGTGTGCAAAGGGGAATCTTTGGTTCTTTGCCCACTGACCCCGTTCAGGCAGAAAAGCAGGTTCGTAAG
CTTCTGGCGTCACCTACATTTAAATTACGGCAACAACAGTTAACTGCGGCCTGGCAGGGGGTAATGAAAG
CCTGGTCTTTGGGCCTGGAGAAATATCCGGCAGTGGTATTCGATGACCAGTGGGTAGTGTACGGAACCAC
CGATATCGACGTGGCTACGCAGCAGTTCACCCTCTGGCGGGAGACTAATCAATGA
 Primer design