SecReT4
Protein ID: 153948995
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3700
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4174791..4176197 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDA7FN26
KEGG IDypi:YpsIP31758_3700
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 468 a.a.     [Download]
>gi|153948995|ref|YP_001402654.1| hypothetical protein YpsIP31758_3700 [Yersinia pseudotuberculosis IP 31758]
MTQHNYFFLQLMATAFVLIGSVAAGAASVSNNGLSASGAISDGLFYSIGGGTVISPSSSRNNMTRLGMTG
SWNSDLMCGNFDLKTTVGNQLNGVTSGFKDLMSDVIQGATGAVASMPAMVIQRANPGLYEMLTNGMLQAG
LSFDKSKLNCQNLAKKMADYTLGNKWTQAAVAEEYKSIVASSDGDAVSSDHQLHKATGEEGTTWIGGRKR
GGKGQPAIKPTYDLAKAGYNMMNNLPVTSNHSIVAVNCNGAVCLRYKNSEEAATAVVKVLGDRSIRTCRE
ASACSSGGGENRSGSTVAGSGFSPMIEETTKENLEQLIKLVGGREKPTTESLAKLKTGGLVVTRGVIQSL
KDDPDNSALIQRLAGELAMADTVENALTMRRMLTTGQAEPNAADQPEALAEGDRRIEALDRELAALRNEM
ELRKAISNNSLLTTLERQGRRNQDNRLQQQSGDQDQGFSQMSQKTREP
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4176197-4174791 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGACACAGCATAATTATTTCTTCCTGCAGCTGATGGCTACGGCTTTCGTGTTAATTGGCAGCGTTGCTG
CTGGTGCGGCTTCTGTATCCAATAATGGCTTGTCAGCAAGTGGTGCCATCAGCGATGGCTTGTTCTACTC
CATCGGGGGCGGCACCGTCATTTCGCCATCTTCTTCACGAAACAACATGACCCGCTTGGGCATGACTGGA
AGCTGGAATAGTGACCTGATGTGCGGCAATTTTGACCTGAAAACCACGGTAGGTAATCAGCTCAATGGGG
TAACCAGCGGTTTTAAGGATTTGATGAGTGATGTGATTCAAGGGGCGACTGGAGCGGTGGCCAGCATGCC
AGCGATGGTTATCCAACGCGCTAATCCGGGCCTGTATGAAATGCTGACCAATGGGATGCTACAAGCTGGT
CTGAGCTTCGATAAATCAAAACTCAACTGTCAGAATTTGGCGAAAAAAATGGCCGATTACACCCTGGGGA
ACAAGTGGACGCAGGCTGCGGTGGCTGAAGAATACAAGAGCATTGTTGCCTCAAGTGACGGTGATGCGGT
TAGCAGCGACCATCAATTACACAAGGCTACCGGCGAAGAGGGCACCACCTGGATTGGCGGGCGGAAGCGC
GGTGGCAAAGGCCAGCCAGCCATTAAGCCCACGTATGATCTCGCTAAAGCGGGTTACAACATGATGAATA
ATCTGCCGGTTACCAGTAACCACTCGATAGTCGCCGTAAACTGCAATGGGGCAGTTTGTCTGCGCTATAA
AAACTCAGAAGAAGCCGCGACCGCAGTGGTAAAAGTGCTCGGTGATCGTTCTATACGCACCTGCCGCGAA
GCCAGTGCGTGCAGCAGCGGTGGTGGCGAGAACAGGTCTGGCAGTACCGTTGCGGGCAGCGGATTTTCTC
CCATGATTGAAGAAACTACCAAAGAGAATCTGGAGCAATTGATCAAGTTGGTTGGCGGGCGGGAGAAACC
CACAACAGAAAGTCTGGCGAAGCTAAAAACGGGAGGCCTTGTTGTTACCCGAGGAGTGATCCAATCGCTG
AAAGATGATCCAGACAATTCGGCGTTGATACAGCGGCTGGCGGGTGAGTTGGCCATGGCTGACACCGTGG
AAAATGCGCTGACCATGCGACGGATGCTCACTACCGGCCAGGCGGAGCCTAATGCCGCCGATCAGCCTGA
AGCCCTGGCCGAAGGAGACCGGCGTATTGAGGCACTGGATCGCGAGCTTGCCGCACTGCGTAATGAAATG
GAACTGCGTAAGGCCATCAGTAATAACAGCCTGCTTACCACGCTTGAGCGTCAGGGGCGACGTAATCAGG
ACAACCGTCTACAGCAGCAGAGCGGGGATCAAGATCAGGGCTTTAGCCAGATGAGCCAGAAAACGAGAGA
ACCCTAA
 Primer design