SecReT4
Protein ID: 153949357
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3718
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4195489..4197609 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDA7FN44
KEGG IDypi:YpsIP31758_3718
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 4.1e-16, Aligned region: 504..634
TrwB_AAD_bind [PF10412], Evalue: 2e-13, Aligned region: 186..225
TrwB_AAD_bind [PF10412], Evalue: 2e-13, Aligned region: 500..645
AAA_10 [PF12846], Evalue: 3.1e-12, Aligned region: 187..581
Protein Sequence: 706 a.a.     [Download]
>gi|153949357|ref|YP_001402672.1| hypothetical protein YpsIP31758_3718 [Yersinia pseudotuberculosis IP 31758]
MSDKYVMESLLRPAVELYTAATAWSAVYICLTAPWAVALAPSVSWVTAAGFSVFALKRTHQGLRILRYRR
NIRRLPRYAMSSRHIPISHRYLFLGRGFQWTQKHTQRLLEARHPETEHYVQPSVIYRMARDLEKRLESRL
PWLCRLTQADTGLNPVRPLPPVGGSPIYHGVELNERDVLYDLGDRVGHTLVIGTTRVGKTRLAEVLVTQD
IRRGDVTVMFDPKGDADLLKRMWAETRRAGRENEFYVFHLGWPDISARYNAIGRFSRISEVASRVAGQLS
GEGNSAAFREFAWRFVNIITRALVALGQRPDYGLILRYVTNIGELYETYVENLLTVQAPQLWLNVQNVIS
SNMLKERDLPRNMQGQANAMKVWAIETVLSSDAGKKLWDPVLDGLRSAVRYDRTYFDKIVASLLPLLEKL
TTGKTAALLAPDYNDMKDTRPIFDWQEVIRKKGIVYVGLDALSDPEVASAVGNSMFADLVSVAGHIYKFG
ISDEIGAKTQKKVPINLHCDEFNELMGDEFIPLINKGGGAGIQVTAYTQTLSDIEARVGSSAKAKQVVGN
FNSLIMLRVRENSTAELLTSQLPEVDVYTKTLVSGVTDMANPEQDSDFTSNVQDRVSSIRMPMVTPADII
NLPKGQAFALLEGGQLWKVRMPLPDGSNDPLMPESISRIVEYMQQNYRTGENWWLGSALPSDILAASDFS
QGDAEN
 
Nucleotide Sequence: 2121 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4197609-4195489 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAGCGATAAATATGTGATGGAATCCCTGTTGCGTCCCGCCGTCGAATTGTACACGGCAGCCACGGCGT
GGAGCGCCGTTTACATTTGCCTGACGGCACCCTGGGCGGTGGCATTGGCACCGTCTGTTAGTTGGGTGAC
GGCGGCGGGCTTTAGTGTTTTTGCTTTGAAACGAACCCACCAAGGGCTGCGTATTCTGCGCTACCGGCGC
AACATCCGGCGGCTGCCCCGTTATGCAATGAGTAGCCGACACATCCCCATTAGTCACCGATATCTGTTTC
TGGGGCGCGGGTTTCAGTGGACACAAAAACACACGCAGCGGCTGCTGGAAGCGCGTCATCCAGAGACCGA
ACATTATGTGCAGCCATCGGTTATCTATCGTATGGCTCGGGATTTGGAGAAACGTCTGGAATCCCGCTTG
CCATGGTTGTGTCGGCTGACGCAGGCCGATACGGGTTTAAATCCGGTAAGACCGCTGCCGCCCGTCGGGG
GCAGCCCAATCTATCACGGTGTTGAATTAAATGAACGTGACGTTCTGTATGACTTGGGAGACCGTGTCGG
CCACACGCTGGTTATCGGAACCACCCGCGTGGGGAAAACTCGTTTAGCAGAGGTGCTGGTCACGCAAGAT
ATTCGTCGCGGGGACGTGACCGTCATGTTCGATCCTAAAGGGGATGCCGATCTGCTTAAACGTATGTGGG
CGGAAACGCGTAGAGCGGGGAGGGAGAATGAGTTTTACGTATTCCATCTGGGCTGGCCAGATATCAGCGC
CCGTTACAACGCCATAGGTCGCTTCAGCCGTATCTCTGAAGTCGCTTCACGCGTGGCCGGGCAATTATCC
GGTGAAGGTAATTCAGCCGCGTTTCGTGAATTCGCCTGGCGCTTTGTGAACATCATTACCCGCGCATTAG
TCGCCCTTGGGCAGCGCCCTGATTACGGGCTCATCCTGCGTTATGTGACCAATATTGGCGAACTTTATGA
GACTTATGTAGAAAACCTGCTGACAGTACAAGCCCCTCAGCTCTGGCTGAATGTTCAGAACGTGATCAGT
TCGAACATGCTGAAAGAGCGTGATCTTCCCCGAAATATGCAGGGCCAGGCCAATGCCATGAAAGTGTGGG
CGATCGAGACGGTACTCAGCAGTGATGCCGGCAAGAAATTGTGGGATCCAGTGCTGGATGGTCTACGCAG
TGCGGTTCGTTATGATCGTACCTATTTTGACAAGATCGTGGCTTCGTTACTGCCACTGTTGGAAAAGCTC
ACTACCGGTAAAACCGCGGCTCTGCTGGCACCTGATTACAATGATATGAAAGATACGCGGCCAATTTTTG
ACTGGCAGGAAGTGATCCGTAAAAAGGGGATTGTGTATGTCGGTCTCGATGCACTGTCTGATCCTGAAGT
GGCGTCGGCGGTGGGCAACAGTATGTTTGCTGATCTGGTCTCAGTTGCGGGCCATATCTACAAATTTGGC
ATCAGTGATGAAATTGGCGCTAAAACGCAGAAGAAAGTGCCGATTAACCTGCATTGCGACGAGTTCAACG
AGTTGATGGGGGATGAGTTCATCCCATTAATTAACAAAGGGGGCGGGGCAGGTATCCAGGTGACGGCGTA
CACTCAGACGCTTTCAGACATTGAAGCGCGAGTGGGCAGTAGTGCTAAAGCGAAGCAGGTTGTTGGTAAT
TTCAACTCCCTGATTATGCTAAGGGTACGTGAAAACAGCACCGCCGAACTGCTGACCAGCCAACTGCCGG
AAGTTGATGTTTATACTAAAACGCTGGTCTCTGGCGTAACGGATATGGCTAACCCTGAGCAGGATTCTGA
TTTCACCAGTAATGTACAAGACCGTGTGAGTAGCATCCGTATGCCCATGGTCACGCCAGCAGATATTATC
AACCTGCCCAAAGGTCAGGCGTTTGCACTGCTCGAAGGTGGGCAACTGTGGAAGGTCAGAATGCCTCTTC
CTGATGGTAGCAATGATCCGTTGATGCCGGAAAGTATCAGCCGGATAGTCGAATACATGCAGCAGAATTA
CCGTACTGGGGAAAATTGGTGGTTGGGGAGTGCGCTACCGTCCGATATTTTGGCCGCGTCAGATTTTAGT
CAAGGGGACGCTGAAAATTAA
 Primer design