SecReT4
Protein ID: 153949391
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3736
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4211230..4212300 [-]
Productpilus biogenesis protein
Component typeTfc2
UniProt IDA7FN62
KEGG IDypi:YpsIP31758_3736
PDB IDNA
Domain hit(s) vs Pfam TcpQ [PF10671], Evalue: 1.2e-21, Aligned region: 268..351
Protein Sequence: 356 a.a.     [Download]
>gi|153949391|ref|YP_001402690.1| pilus biogenesis protein [Yersinia pseudotuberculosis IP 31758]
MAQPNLRPRYKLVWLTLLLLTAGCTHNTTAQYKPLSPVPPIPRVNDIYPNPAPEVVRYDRYTLISSKPVD
AQRDPLNQIMDISMPAEMVRSVGDGFRYVLLESGYSLCPISSPVFAELLNKPLPGVQRSMGPLRLSDALQ
ILAGPAWRLLVDDVNREVCFTLRDAYQNLVSAKPVVPANVIIPTKNLAQQSGNPFSGSSASALTPVVPTL
LVPLKPTIKPESISIPSPVLTEASKVLAPATAVFSTEAPGKTVSGPGTPISVAPSGQLWRAEVGSTLKET
LNRWAGQNKCENGGHWVVIWPVLLDYRIDAPLAFHGNFEYVLVQIFELYRQADKPLFAQASRPQCLVVVS
DIPGGL
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4212300-4211230 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGCACAACCAAATCTGCGGCCCAGATATAAGTTGGTATGGCTCACGCTGTTACTGCTAACCGCTGGCT
GCACCCATAACACTACCGCCCAGTACAAACCGCTTTCACCCGTTCCGCCCATTCCCCGAGTCAATGATAT
TTACCCCAATCCTGCTCCAGAGGTTGTGCGCTATGACCGCTATACTCTGATTAGCAGCAAACCTGTTGAT
GCGCAGCGTGATCCGCTGAACCAAATAATGGACATCAGCATGCCCGCCGAAATGGTTCGCTCTGTTGGCG
ATGGCTTTCGATATGTATTGCTGGAATCGGGGTACTCATTGTGTCCAATATCATCACCGGTTTTTGCCGA
ACTGCTAAACAAGCCGTTACCTGGGGTTCAACGTTCAATGGGCCCGTTACGCCTTAGTGACGCTTTGCAG
ATCCTTGCGGGACCCGCCTGGCGTTTGCTCGTTGATGATGTTAACCGCGAAGTCTGTTTTACATTACGTG
ATGCCTATCAGAACCTTGTGTCAGCCAAACCGGTAGTGCCAGCCAATGTCATTATCCCTACTAAAAATCT
AGCACAGCAATCTGGAAACCCTTTTTCTGGATCCTCTGCCAGCGCGCTAACACCTGTTGTTCCCACACTT
TTAGTACCGCTTAAACCGACTATAAAGCCTGAAAGTATCTCCATCCCCTCACCCGTATTGACGGAAGCCA
GCAAGGTGTTAGCACCGGCTACTGCGGTTTTCTCAACTGAAGCGCCAGGTAAAACGGTATCTGGCCCAGG
GACGCCGATCTCTGTTGCCCCTTCAGGCCAGCTTTGGCGGGCCGAGGTAGGCTCAACACTCAAAGAAACG
CTGAATCGTTGGGCAGGCCAGAACAAATGTGAGAACGGTGGCCATTGGGTAGTCATCTGGCCGGTTTTAT
TGGATTACCGCATTGATGCGCCATTGGCTTTCCACGGCAATTTTGAATATGTACTCGTTCAGATTTTTGA
GCTTTATCGTCAAGCAGACAAACCCTTGTTTGCGCAAGCCAGCCGCCCGCAATGTCTGGTCGTGGTTAGC
GACATCCCTGGGGGGCTCTGA
 Primer design