SecReT4
Protein ID: 153949553
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3699
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4173268..4174791 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDA7FN25
KEGG IDypi:YpsIP31758_3699
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.2e-111, Aligned region: 8..488
Protein Sequence: 507 a.a.     [Download]
>gi|153949553|ref|YP_001402653.1| hypothetical protein YpsIP31758_3699 [Yersinia pseudotuberculosis IP 31758]
MTANSFLEYFLVLFGWMLNNALWNILLGTGLFALPLVFKVLGIWLKVREEGADEGNKGVLALPRVEHAIY
VSFCVMLFCCIPLLPVDISTVQFDSSRTKQCGVNVPAPQNSGYKALVNDFDGKTAEVPVWWYLLHMVSKG
TTQAMTASIPCGNQLRQLRFDVQNTKIRDPIVLQEVQDFADQCYSRAYFKLKNSNSQLSDATINSVGWMG
SRYFLTVGGYYDHYTSTEPRSLWPYNNNRDNGYPDVGRGGYPTCKQWWSDGTNGLKTRVLANLTAATKIA
LQLRYSKDQWEEMALRWLVSSRNVDLSGRGETYAISGNDATSGLMGNVTRLVSSVGLGLKQAEALPGFDA
LKQALPMIQALLEMMIIIAIPILMMFSAYEPKTVVTISFALFALMFITFWWELAGWLDDRLITILYDNMA
EQGMINSSVPFAGFFSSTADGWIMNLVLGMMYVVFPMFWLGMLSWVGVHLGGAISSAMEKGSVQSKQAGE
EAGKKAQGTAVKRITKA
 
Nucleotide Sequence: 1524 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4174791-4173268 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGACGGCAAACAGTTTCCTTGAATATTTCCTGGTGCTGTTCGGGTGGATGCTAAACAACGCGCTGTGGA
ATATTTTGCTGGGCACAGGACTGTTCGCCTTGCCACTGGTGTTTAAAGTGCTCGGTATTTGGCTAAAAGT
GCGTGAAGAGGGCGCGGATGAAGGCAATAAAGGGGTGCTGGCGCTGCCGCGCGTGGAACATGCCATCTAC
GTATCATTTTGTGTCATGTTGTTTTGCTGCATCCCCTTGCTGCCGGTGGATATCAGCACCGTCCAGTTTG
ACAGCTCCCGCACCAAACAATGTGGTGTAAACGTCCCTGCGCCACAAAATTCTGGTTATAAGGCACTGGT
CAATGATTTTGACGGCAAAACAGCAGAAGTACCGGTGTGGTGGTATCTACTACACATGGTATCGAAAGGC
ACCACTCAGGCTATGACAGCTTCTATCCCTTGTGGTAATCAACTGCGGCAACTGCGTTTTGACGTGCAAA
ACACCAAGATCCGTGACCCCATCGTGCTACAGGAAGTACAGGATTTTGCAGATCAGTGTTACTCGCGCGC
TTACTTTAAGTTGAAGAACAGCAATAGCCAATTGAGTGATGCCACTATCAATAGTGTGGGCTGGATGGGG
AGTCGATATTTTCTCACGGTTGGGGGCTACTATGACCATTACACTTCGACTGAACCGCGCAGTCTGTGGC
CCTATAATAACAACAGAGACAATGGCTATCCTGATGTCGGCCGGGGCGGCTATCCGACGTGTAAACAGTG
GTGGTCTGATGGCACTAACGGCCTAAAAACGCGTGTTCTGGCCAACCTTACCGCCGCCACTAAAATAGCG
CTACAGCTCAGGTACAGTAAAGATCAGTGGGAAGAAATGGCCCTGCGTTGGCTGGTAAGCTCGCGTAACG
TTGACCTATCTGGTCGTGGTGAGACTTATGCAATAAGCGGTAATGATGCCACATCTGGACTGATGGGGAA
CGTCACTCGCCTGGTCTCTTCCGTTGGGTTAGGGTTGAAGCAAGCAGAGGCTTTGCCTGGATTTGATGCG
CTGAAACAGGCGCTGCCAATGATTCAGGCATTACTTGAGATGATGATCATTATCGCCATCCCGATATTAA
TGATGTTCAGTGCCTACGAGCCGAAAACGGTGGTGACTATTTCCTTTGCATTATTTGCCCTGATGTTCAT
TACGTTCTGGTGGGAACTGGCGGGCTGGCTTGATGACAGGTTGATCACTATTCTTTATGACAATATGGCG
GAGCAAGGGATGATTAACAGCAGCGTGCCGTTCGCCGGGTTCTTCAGCTCGACAGCGGATGGTTGGATCA
TGAACCTGGTATTGGGGATGATGTATGTGGTTTTTCCTATGTTTTGGCTGGGAATGCTGAGTTGGGTCGG
CGTACACTTGGGCGGAGCAATTTCATCAGCGATGGAAAAAGGCTCAGTTCAATCCAAGCAGGCAGGGGAA
GAAGCTGGAAAAAAAGCACAAGGGACAGCGGTAAAACGAATAACTAAAGCTTAA
 Primer design