SecReT4
Protein ID: 153949810
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3717
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4194737..4195489 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDA7FN43
KEGG IDypi:YpsIP31758_3717
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2.3e-73, Aligned region: 49..247
Protein Sequence: 250 a.a.     [Download]
>gi|153949810|ref|YP_001402671.1| hypothetical protein YpsIP31758_3717 [Yersinia pseudotuberculosis IP 31758]
MVQENTPPRRNVEPPKKPGLFMSLFWHLPWTIIGILLASWLVSLLIEYIGITFFWASEGAEHSRQVMLTE
SAYLSEGFTRSLLMSEPATLIGYWIQQAYQWLFVDSGFLRWINEGRQVNTPEEALQALNLFGSWLARVLW
EYLQATVYITVIFSIRVTILVLSIPLFIMVCANGVVDGLVRRDLRRYGAGYESSFIYHHAKRFVKPAMYG
PCMLYLSWPTAVWPNLLLLPAAVALGVVVSVVVGAFKKYL
 
Nucleotide Sequence: 753 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4195489-4194737 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGTTCAGGAGAATACGCCGCCACGACGGAACGTTGAACCACCTAAAAAACCGGGCCTGTTTATGTCTC
TGTTCTGGCATCTGCCGTGGACAATTATCGGCATCTTGCTGGCGTCATGGCTGGTCAGCTTATTGATTGA
GTACATCGGCATAACATTTTTCTGGGCCAGCGAAGGGGCAGAACACAGCAGGCAGGTGATGCTCACAGAA
AGCGCATATTTATCTGAGGGTTTTACCCGCAGTCTGTTGATGTCCGAACCGGCTACGCTCATTGGTTATT
GGATTCAACAGGCTTACCAATGGCTGTTTGTAGATAGCGGCTTTCTTCGCTGGATAAATGAGGGACGACA
GGTAAATACACCGGAAGAGGCGCTTCAGGCACTCAATCTTTTCGGTAGTTGGCTGGCCAGGGTGCTCTGG
GAATATTTACAGGCGACAGTCTATATAACGGTTATTTTCTCCATCCGAGTGACCATTTTGGTGCTGTCTA
TCCCGCTGTTTATCATGGTGTGTGCCAATGGCGTCGTGGACGGTTTGGTTCGCCGAGACCTGCGACGTTA
TGGTGCCGGTTACGAATCCAGTTTTATTTATCATCACGCCAAACGCTTTGTTAAACCTGCGATGTATGGG
CCTTGCATGCTGTATTTGTCCTGGCCAACAGCGGTGTGGCCCAATTTACTGCTACTGCCAGCAGCGGTGG
CTCTGGGCGTGGTGGTGTCGGTGGTGGTGGGAGCATTTAAGAAGTATTTGTGA
 Primer design