SecReT4
Protein ID: 153949915
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3698
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4172940..4173236 [+]
Producthypothetical protein
Component typeTfc20
UniProt IDA7FN24
KEGG IDypi:YpsIP31758_3698
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 98 a.a.     [Download]
>gi|153949915|ref|YP_001402652.1| hypothetical protein YpsIP31758_3698 [Yersinia pseudotuberculosis IP 31758]
MSSQGFDPKDLEEICARKPHKYKMNKADYQELGKNLLLGSVDIAVGSVSAAALTASVFMTDETDQSPSQQ
KNGWCHGSQGWGNYVNGEKLHYDEDDLS
 
Nucleotide Sequence: 297 bp     [Download]
>gi|153946813|ref|NC_009708.1|:4172940-4173236 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAGCTCACAAGGTTTTGATCCAAAGGACTTGGAAGAAATTTGCGCCAGAAAGCCCCATAAATACAAGA
TGAACAAGGCTGATTACCAAGAGCTTGGAAAAAATCTGCTACTTGGTTCCGTAGATATTGCCGTCGGAAG
TGTGTCTGCCGCCGCGTTAACAGCATCTGTGTTTATGACAGATGAAACTGATCAATCACCTAGCCAGCAG
AAAAATGGTTGGTGTCATGGCTCTCAAGGCTGGGGTAACTACGTAAATGGCGAGAAACTTCATTATGATG
AAGACGATTTGAGCTGA
 Primer design