SecReT4
Protein ID: 153950384
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3706
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4185306..4185707 [-]
Productlipoprotein
Component typeTfc15
UniProt IDA7FN32
KEGG IDypi:YpsIP31758_3706
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 133 a.a.     [Download]
>gi|153950384|ref|YP_001402660.1| lipoprotein [Yersinia pseudotuberculosis IP 31758]
MKKTIKFASIPLLFAVVTLAGCSTSKDQMLPPGGSTMLTLWNDSSSATHATREGRTTLRRTLMEPLDLVT
ETGSRIQENEIQDRFPRLPNPDLVMFVYPHFAGSHTPVPGYSTVFPFYSQVQYALPGERTVEL
 
Nucleotide Sequence: 402 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4185707-4185306 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAAAAAAACAATCAAGTTCGCTTCTATCCCACTTCTTTTTGCTGTCGTGACGTTGGCGGGTTGCAGTA
CCAGTAAAGATCAAATGTTACCGCCGGGCGGCAGCACCATGCTGACACTGTGGAACGATAGTTCATCAGC
CACTCATGCAACCCGTGAAGGGCGGACAACGTTGCGCCGCACTCTGATGGAGCCGTTGGATCTGGTGACT
GAAACTGGCAGCCGCATCCAAGAAAATGAGATACAGGACAGGTTCCCACGGCTGCCTAATCCCGATTTGG
TGATGTTTGTTTATCCTCACTTCGCGGGCAGTCATACGCCGGTGCCGGGTTATAGCACCGTATTTCCATT
CTATAGCCAGGTTCAGTATGCCCTTCCGGGTGAACGCACGGTGGAATTGTGA
 Primer design