SecReT4
Protein ID: 153950424
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3707
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4185720..4187237 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDA7FN33
KEGG IDypi:YpsIP31758_3707
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 505 a.a.     [Download]
>gi|153950424|ref|YP_001402661.1| hypothetical protein YpsIP31758_3707 [Yersinia pseudotuberculosis IP 31758]
MKIKSNVLVKFLVPLVILGAVLIGVKTYSTGGEKSTALVNASNVLADLTPDDLKAIGIEGDTPQDTLRTL
VGSLKMVTTRQNQLDADNKALADESKTLKQADQNIDERINQAIAAYQADANKDQGQLKGQVREMTIQIGD
LMQKLKAEGWAAKHLAAGSDIPVGLGLASGGNAVSVLDNDSLQWTENLQWSEPQDGVAIDVTGKPVGESN
HNIASRNIANSFTFATSFLDDNAITRQKAELANQTNYRQILNDNHAAEGSVEPVYTLPENSTLIGSRAMT
ALLGRVPIDGKVTDPYPFKVLIGKENLTANGIDLPDIQGAIVSGSATGDWTLSCVRGSVTSITFVFTDGT
VRTLPRQTEGHQNNNNGSSIGWLSDENGIPCLSGERKSNAATWLPTLFALSASAAAGEVLAQSQNTAQTN
ANGGVTSTLTGDAGQAVMGKALSGGMQAAAEWVKGRYGQTFDAIYVPPGVKVAVHITRQLAIDYEEKGRK
VKHDFRLNQTETGMD
 
Nucleotide Sequence: 1518 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4187237-4185720 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAAGATTAAATCCAACGTGTTAGTCAAGTTTCTTGTCCCACTGGTCATTTTGGGGGCCGTGCTGATCG
GCGTGAAAACCTACTCGACGGGAGGCGAAAAATCTACGGCATTGGTTAACGCCAGCAATGTGTTAGCCGA
TTTGACCCCGGACGATCTCAAGGCCATAGGCATTGAAGGGGATACGCCACAGGACACGCTACGCACGCTG
GTTGGCAGCCTGAAAATGGTCACGACTCGTCAGAATCAACTCGATGCTGACAATAAAGCCCTGGCGGATG
AGAGCAAAACCCTAAAGCAGGCAGATCAGAATATCGATGAGCGTATTAATCAGGCCATTGCCGCTTATCA
AGCCGATGCCAATAAAGATCAAGGGCAGCTAAAAGGGCAGGTTCGGGAGATGACGATCCAGATTGGCGAT
TTAATGCAAAAGCTCAAGGCTGAGGGTTGGGCGGCAAAACATCTCGCCGCCGGCAGCGATATCCCCGTAG
GGCTGGGTTTAGCGAGTGGGGGAAACGCGGTGTCAGTTTTAGATAACGATAGTTTGCAATGGACTGAAAA
TTTGCAGTGGAGCGAACCTCAAGATGGTGTGGCTATCGATGTGACGGGTAAGCCGGTTGGCGAAAGCAAC
CACAATATCGCCAGTCGTAATATCGCCAATAGTTTTACCTTTGCGACCTCTTTTTTAGATGACAACGCGA
TCACTCGTCAGAAAGCCGAGCTGGCGAATCAAACCAATTATCGGCAGATCCTGAATGATAATCATGCGGC
GGAAGGATCAGTCGAGCCAGTGTATACCTTACCGGAGAACTCCACGTTGATTGGCAGCCGTGCTATGACG
GCGCTGCTTGGACGTGTACCTATCGATGGCAAAGTCACCGATCCGTATCCATTCAAGGTTCTGATTGGAA
AAGAAAACCTAACAGCCAACGGTATCGATTTACCCGATATTCAGGGCGCTATTGTTTCTGGTAGCGCAAC
AGGCGATTGGACGCTGTCTTGTGTCCGTGGTTCGGTCACCAGTATCACCTTCGTATTCACTGATGGCACC
GTGCGCACCTTGCCGCGCCAGACTGAAGGTCACCAAAACAACAATAACGGCAGCAGCATTGGCTGGTTGT
CTGATGAAAACGGTATTCCGTGTTTATCAGGAGAGCGTAAATCGAATGCCGCGACCTGGCTGCCAACCCT
CTTTGCATTATCTGCCAGCGCCGCAGCGGGTGAAGTGTTGGCCCAAAGTCAAAACACGGCCCAGACCAAT
GCTAATGGCGGAGTGACATCAACGTTGACGGGTGATGCAGGGCAGGCGGTGATGGGTAAGGCGTTATCTG
GAGGGATGCAAGCAGCAGCGGAGTGGGTTAAAGGGCGCTATGGACAGACTTTTGACGCAATTTATGTTCC
ACCGGGCGTCAAGGTGGCTGTCCATATTACGCGCCAGTTAGCGATCGACTACGAAGAAAAAGGCCGAAAA
GTGAAGCATGATTTTCGTCTGAATCAAACTGAAACGGGCATGGACTGA
 Primer design