SecReT4
Protein ID: 153951366
T4SS name [ID]Tra_F [800]
Gene symbol-
Locus tagJJD26997_0937
StrainCampylobacter jejuni subsp. doylei 269.97
Repliconchromosome [GenBank: NC_009707] [Browse all T4SS(s) in this replicon]
Location [Strand]835154..835657 [+]
Productputative type IV secretory protease
Component typeTraF_F
UniProt IDA7H3H1
KEGG IDcjd:JJD26997_0937
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.5e-12, Aligned region: 73..162
Protein Sequence: 167 a.a.     [Download]
>gi|153951366|ref|YP_001398051.1| putative type IV secretory protease [Campylobacter jejuni subsp. doylei 269.97]
MKLSKEQIRTLINKTLFVLIAFIIGNIVVSALSQFYGISVIHTKSIDKDIFIYQKKFQGDLKDSLIYFSL
PVQTRYFDKDSNFGKYVRCEEGQTLSVKGLKYYCDNVFLGIAQKTDKDGNKVEQFIFNGVIPKDKFFVMG
THPRSFDSRYWGFVDRKDIKGVSIWAI
 
Nucleotide Sequence: 504 bp     [Download]
>gi|153950938|ref|NC_009707.1|:835154-835657 Campylobacter jejuni subsp. doylei 269.97 chromosome, complete genome
ATGAAACTAAGTAAAGAACAAATTAGAACGCTTATCAATAAAACTTTGTTTGTTCTAATTGCTTTTATTA
TTGGAAATATAGTTGTTTCAGCTCTATCTCAATTTTATGGAATAAGCGTAATTCATACCAAAAGCATTGA
TAAAGATATTTTCATATATCAAAAAAAGTTTCAAGGAGATTTAAAAGATTCTTTAATTTATTTCTCTTTA
CCTGTGCAAACAAGATATTTTGATAAGGATTCGAACTTTGGAAAATATGTAAGATGTGAAGAAGGACAAA
CATTAAGTGTGAAAGGTTTGAAATATTATTGTGACAATGTTTTTTTGGGTATTGCTCAAAAAACAGATAA
GGATGGAAATAAAGTAGAGCAATTTATATTTAACGGAGTCATACCAAAAGATAAGTTTTTTGTAATGGGA
ACACATCCTAGAAGCTTTGATAGTAGGTATTGGGGTTTTGTAGATAGAAAAGATATTAAAGGAGTTTCTA
TATGGGCGATTTAA
 Primer design