SecReT4
Protein ID: 153951514
T4SS name [ID]Tra_F [800]
Gene symbol-
Locus tagJJD26997_0974
StrainCampylobacter jejuni subsp. doylei 269.97
Repliconchromosome [GenBank: NC_009707] [Browse all T4SS(s) in this replicon]
Location [Strand]858793..859566 [-]
Producthypothetical protein
Component typeTraF_F
UniProt IDA7H3K5
KEGG IDcjd:JJD26997_0974
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.2e-45, Aligned region: 27..245
Protein Sequence: 257 a.a.     [Download]
>gi|153951514|ref|YP_001398085.1| hypothetical protein JJD26997_0974 [Campylobacter jejuni subsp. doylei 269.97]
MIKISTTILIIVCYLHASTFFGDSKRGWFYYELADNNNSQEKNETKVQKRMNADDLFIASIPLNNLDLLT
AEEFTETFEKVRKIAIMNPTKTNVMTMQIMNKWQVDQSEKFAKVWVLNLLENPNLEYPEIRDDKFGRSEM
FRQKQEKINNFYKAHQDDFSYVVFVSNLNKESNEKQKGIYRSLQSDYGVNVEYVNVDERKDLISKFKLTT
TPENFFVYKNSKGEAIWQRVKSGLTNKDDIINNTLFLFDNAILEKDK
 
Nucleotide Sequence: 774 bp     [Download]
>gi|153950938|ref|NC_009707.1|:c859566-858793 Campylobacter jejuni subsp. doylei 269.97 chromosome, complete genome
ATGATAAAAATATCTACAACAATTCTTATTATAGTTTGTTATTTGCATGCAAGTACTTTTTTTGGTGATT
CAAAGCGCGGTTGGTTTTATTATGAACTTGCTGACAATAATAATTCACAGGAAAAAAATGAAACCAAAGT
CCAAAAAAGGATGAATGCAGATGATTTATTTATAGCTTCAATACCTTTAAACAACTTAGATCTTTTAACA
GCCGAGGAATTTACTGAAACCTTCGAAAAAGTTAGAAAAATAGCCATCATGAATCCCACAAAAACAAATG
TGATGACAATGCAAATTATGAATAAGTGGCAAGTTGATCAATCTGAAAAATTTGCTAAAGTTTGGGTTTT
AAACCTTTTAGAAAATCCAAACTTAGAGTATCCAGAAATTCGCGATGACAAATTTGGCAGAAGCGAAATG
TTTAGACAAAAACAAGAAAAAATAAACAATTTTTATAAAGCTCATCAAGATGATTTTTCTTATGTTGTTT
TTGTTAGTAATTTAAATAAAGAAAGTAATGAAAAACAAAAAGGCATATATCGCTCGCTACAAAGCGATTA
TGGTGTAAATGTTGAATATGTTAATGTAGATGAGCGTAAAGACTTGATTTCAAAATTTAAACTTACAACG
ACTCCTGAAAATTTCTTTGTTTATAAAAACTCAAAAGGAGAGGCAATTTGGCAAAGAGTTAAGTCAGGAC
TCACAAACAAAGATGATATCATCAACAATACTTTGTTTTTATTTGATAACGCGATTTTAGAGAAAGATAA
ATAA
 Primer design