SecReT4
Protein ID: 153951858
T4SS name [ID]Tra_F [800]
Gene symbol-
Locus tagJJD26997_0929
StrainCampylobacter jejuni subsp. doylei 269.97
Repliconchromosome [GenBank: NC_009707] [Browse all T4SS(s) in this replicon]
Location [Strand]827819..828124 [+]
Productputative sex pilus assembly
Component typeTraL_F
UniProt IDA7H3G3
KEGG IDcjd:JJD26997_0929
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.2e-08, Aligned region: 11..100
Protein Sequence: 101 a.a.     [Download]
>gi|153951858|ref|YP_001398043.1| putative sex pilus assembly [Campylobacter jejuni subsp. doylei 269.97]
MAKTENGYVEINKFIDTKPMFGNWEVDTLAIFSIFIAIAIMFARGAIAFGIFFALGVVAAKYYEKLKKSR
VKGFFFHIIYMLGLRQPKTLPPSYMRYFLGA
 
Nucleotide Sequence: 306 bp     [Download]
>gi|153950938|ref|NC_009707.1|:827819-828124 Campylobacter jejuni subsp. doylei 269.97 chromosome, complete genome
TTGGCAAAAACTGAAAATGGCTATGTTGAAATAAATAAATTTATAGATACAAAACCTATGTTTGGTAATT
GGGAAGTTGATACTTTAGCTATATTTAGTATATTTATAGCTATCGCAATTATGTTTGCAAGAGGTGCTAT
TGCTTTTGGGATTTTTTTTGCTCTTGGGGTTGTCGCTGCAAAATATTATGAGAAGTTAAAAAAGTCAAGA
GTAAAAGGTTTTTTCTTTCATATCATTTATATGCTAGGTTTAAGACAACCTAAAACTTTACCTCCTTCGT
ACATGAGATATTTTTTAGGAGCTTAA
 Primer design