SecReT4
Protein ID: 153952379
T4SS name [ID]Tra_F [800]
Gene symbol-
Locus tagJJD26997_0926
StrainCampylobacter jejuni subsp. doylei 269.97
Repliconchromosome [GenBank: NC_009707] [Browse all T4SS(s) in this replicon]
Location [Strand]824881..826377 [-]
ProductF-box only protein 18
Component typeTraI_F
UniProt IDA7H3G0
KEGG IDcjd:JJD26997_0926
PDB IDNA
Domain hit(s) vs Pfam UvrD_C [PF13361], Evalue: 6.9e-13, Aligned region: 361..477
UvrD-helicase [PF00580], Evalue: 4.3e-12, Aligned region: 141..250
Viral_helicase1 [PF01443], Evalue: 3.9e-11, Aligned region: 188..282
UvrD_C_2 [PF13538], Evalue: 6.7e-10, Aligned region: 356..476
Protein Sequence: 498 a.a.     [Download]
>gi|153952379|ref|YP_001398040.1| F-box only protein 18 [Campylobacter jejuni subsp. doylei 269.97]
MSISCLQTKNSLTQEQQAVVDFNIDDILIVNAYAGTGKTSTLVQFCEARKDFNILYLSYNSSMRKEAETK
FKHLKNVEVKTMHSLAYIELEVQKKYKDRLGSLRAIDLFNFTGDLKEEVKSFYATAILKAVRYFCNSNLE
LKEFLKEIAKEPSKYEISPKMDLSYISKKTEKLWNDLQSQDCALVYEHDFYLKSYQLSKPKLEYDFILVD
EAQDINACVIDIVLNQKQTKKVFIGDAFQSIYKFRGAVNSLEVLASMPKSHILYLTQSFRCPQSIATIAN
SYLGILNASRDFKGTLKPRKENNENEAKAIICRTNAKLFDIAVENLNKKLFFVGGVNSYSFDELLDIQNL
LFKKHKSIKNQFIAKFADLKELLEYINETKEVDLKQKIFVLFKYVHSDIIKLIKDIEKSCVKKQEQADLI
LSTGHKSKGLEWNNVEIINDFLNIKQELEGREQITIAKEELNLLYVAVTRAKNSLNINKDYLLEKDFMEK
NLERIIIE
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|153950938|ref|NC_009707.1|:c826377-824881 Campylobacter jejuni subsp. doylei 269.97 chromosome, complete genome
GTGTCAATTTCTTGTTTACAAACTAAAAATTCTCTCACTCAAGAGCAACAAGCTGTGGTTGATTTTAATA
TTGATGATATATTAATAGTGAATGCTTACGCAGGCACAGGAAAAACATCTACTCTAGTGCAATTTTGTGA
AGCAAGAAAAGATTTTAACATTTTGTATCTATCTTATAATTCTTCCATGCGAAAAGAAGCTGAAACTAAA
TTCAAACACTTAAAAAATGTAGAAGTTAAAACCATGCACTCTCTTGCATACATAGAGTTAGAAGTTCAAA
AAAAATATAAAGATAGATTAGGAAGCTTAAGAGCTATAGATTTATTTAATTTTACAGGGGATTTAAAAGA
AGAGGTTAAAAGTTTTTATGCAACTGCTATTTTAAAAGCTGTTCGATATTTTTGCAACAGCAATCTTGAG
CTAAAAGAATTTTTAAAAGAAATAGCAAAAGAGCCTTCCAAATATGAAATTAGTCCGAAAATGGATTTAT
CCTATATTTCAAAAAAAACAGAAAAATTGTGGAATGATTTACAAAGTCAAGATTGCGCTCTTGTCTATGA
ACACGATTTTTATTTGAAATCCTATCAACTTTCAAAGCCAAAATTAGAATATGATTTTATATTAGTAGAT
GAAGCACAGGATATTAATGCTTGTGTTATTGATATTGTGCTTAACCAAAAGCAAACTAAAAAAGTTTTTA
TAGGAGATGCATTTCAAAGCATTTATAAATTCAGAGGTGCTGTGAATTCCTTAGAAGTATTAGCATCTAT
GCCAAAATCTCATATTTTGTATCTAACTCAAAGCTTTAGATGCCCACAAAGTATAGCTACTATTGCCAAT
TCTTATTTGGGAATTTTAAATGCCTCAAGAGATTTTAAAGGAACGCTAAAACCAAGAAAGGAAAATAATG
AAAATGAAGCAAAAGCTATAATATGCAGAACTAATGCTAAACTATTTGATATAGCAGTAGAAAATTTAAA
TAAAAAATTATTTTTTGTGGGAGGGGTAAATAGTTATAGTTTTGATGAATTATTAGACATACAAAATCTT
CTTTTTAAAAAACACAAATCTATCAAAAATCAGTTTATTGCAAAATTTGCCGACTTAAAAGAACTTCTTG
AATATATCAACGAAACTAAAGAGGTTGATTTAAAACAAAAAATATTTGTTCTTTTTAAATATGTGCATAG
CGATATTATAAAGCTTATCAAAGATATTGAAAAAAGCTGTGTTAAAAAACAAGAACAAGCTGATTTGATA
TTAAGCACAGGACACAAGAGCAAAGGTTTAGAGTGGAATAATGTTGAAATTATTAATGATTTTTTAAACA
TCAAGCAAGAACTTGAAGGAAGAGAACAAATTACCATAGCAAAAGAAGAATTAAATCTTTTGTATGTGGC
AGTTACAAGAGCTAAAAATTCTTTAAATATCAACAAAGATTATTTGCTTGAAAAAGATTTTATGGAAAAA
AATTTAGAAAGGATAATAATAGAATGA
 Primer design