SecReT4
Protein ID: 153971616
T4SS name [ID]Tra_F [515]
Gene symboltraA
Locus tagpC46021_05
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]20379..20666 [+]
Productputative conjugative transfer protein TraA
Component typeTraA_F
UniProt IDA7DVG6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 2.2e-05, Aligned region: 15..92
Protein Sequence: 95 a.a.     [Download]
>gi|153971616|ref|YP_001393134.1| putative conjugative transfer protein TraA [Vibrio vulnificus]
MNTRTQRTLAFTVGLAVSALLVTQPALAADIFATGKQAMKDTAGKGSTVETAMLGTGLFGAVVTGLMTRN
WFAALGGFAGGSILWNVGAPLVGLG
 
Nucleotide Sequence: 288 bp     [Download]
>gi|153971581|ref|NC_009702.1|:20379-20666 Vibrio vulnificus pC4602-1 plasmid
ATGAACACTCGCACTCAACGCACTTTAGCTTTCACTGTTGGACTGGCCGTTTCTGCACTTCTGGTGACAC
AGCCAGCGTTAGCCGCCGATATTTTTGCCACCGGTAAGCAAGCGATGAAAGACACCGCAGGTAAAGGATC
GACTGTCGAAACGGCCATGCTCGGCACTGGATTATTTGGTGCCGTTGTCACCGGATTAATGACCCGTAAC
TGGTTTGCCGCCCTCGGCGGTTTTGCTGGCGGCTCTATTTTGTGGAACGTTGGAGCGCCACTCGTTGGGC
TTGGTTAA
 Primer design