SecReT4
Protein ID: 153971617
T4SS name [ID]Tra_F [515]
Gene symboltraL
Locus tagpC46021_14
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]20676..20978 [+]
Productputative conjugative transfer protein TraL
Component typeTraL_F
UniProt IDA7DVG7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.5e-31, Aligned region: 7..99
Protein Sequence: 100 a.a.     [Download]
>gi|153971617|ref|YP_001393135.1| putative conjugative transfer protein TraL [Vibrio vulnificus]
MEDPHQFFSIPKHMNKGRRLLGFPADEIAPALIIFGLSFWLKHEMIGLALSLGWFGGLRYIKAQYGDNII
ILSLYWWGASFVSPTFFKRTPSACRRYWIF
 
Nucleotide Sequence: 303 bp     [Download]
>gi|153971581|ref|NC_009702.1|:20676-20978 Vibrio vulnificus pC4602-1 plasmid
ATGGAAGACCCTCATCAGTTTTTCTCTATCCCCAAACACATGAACAAAGGACGCCGGTTACTCGGCTTCC
CAGCCGATGAAATCGCACCTGCCTTAATCATCTTCGGGCTCTCATTTTGGCTCAAACACGAGATGATAGG
GCTGGCTTTATCACTAGGCTGGTTTGGGGGGCTACGCTACATCAAAGCGCAATACGGTGACAACATCATC
ATTTTGTCCCTGTATTGGTGGGGCGCTTCCTTTGTCAGCCCCACTTTCTTTAAACGCACTCCCTCCGCTT
GTCGGAGGTATTGGATTTTTTAA
 Primer design