SecReT4
Protein ID: 153971618
T4SS name [ID]Tra_F [515]
Gene symboltraE
Locus tagpC46021_08
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]20993..21568 [+]
Productputative conjugative transfer protein TraE
Component typeTraE_F
UniProt IDA7DVG8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.3e-72, Aligned region: 1..186
Protein Sequence: 191 a.a.     [Download]
>gi|153971618|ref|YP_001393136.1| putative conjugative transfer protein TraE [Vibrio vulnificus]
MDPYIKRDRLAIKSLLNFLLVAGFLAMLITNLVLGYTSYQALTHQSRTLIPPTISKAFTVSDGAVDEPYL
EQMADYLLYLKLNVTPANVSRQFGQLLEYVDAQSWNNVQPKLLREATVIKKDNISSQFSVDSIRISLDTL
QVQLYGKLQKYVGRRALEPEMKWYQVSFSYEQGSIGLLSIEEVEVKNDESP
 
Nucleotide Sequence: 576 bp     [Download]
>gi|153971581|ref|NC_009702.1|:20993-21568 Vibrio vulnificus pC4602-1 plasmid
ATGGACCCGTACATTAAGCGGGATAGGTTAGCCATCAAAAGCCTGCTCAACTTCTTATTAGTGGCAGGCT
TTCTTGCTATGCTTATCACCAACCTGGTATTGGGTTACACCAGTTATCAAGCCCTAACCCACCAAAGCCG
TACGCTCATCCCACCGACCATTTCAAAAGCCTTTACGGTTTCTGACGGCGCAGTCGATGAGCCTTACCTT
GAGCAGATGGCCGATTATCTACTCTACCTAAAACTCAACGTCACCCCCGCAAACGTCTCTCGCCAGTTTG
GACAGCTCCTTGAGTATGTCGATGCACAAAGCTGGAACAACGTACAACCTAAGCTACTTCGAGAGGCAAC
CGTCATTAAAAAAGACAACATAAGCAGCCAATTTTCTGTCGATTCCATCCGCATTTCGCTCGACACCCTC
CAAGTGCAACTCTACGGCAAACTGCAAAAGTACGTGGGACGGCGCGCTTTAGAGCCTGAAATGAAATGGT
ATCAAGTGAGTTTTAGCTATGAGCAAGGCTCAATAGGCTTACTCTCCATTGAAGAAGTCGAGGTCAAGAA
CGATGAATCTCCATAA
 Primer design