SecReT4
Protein ID: 153971619
T4SS name [ID]Tra_F [515]
Gene symboltraK
Locus tagpC46021_13
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]21555..22340 [+]
Productputative conjugative transfer protein TraK
Component typeTraK_F
UniProt IDA7DVG9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 2.1e-57, Aligned region: 26..250
Protein Sequence: 261 a.a.     [Download]
>gi|153971619|ref|YP_001393137.1| putative conjugative transfer protein TraK [Vibrio vulnificus]
MNLHKQSLPPQPRWHSHLVSITLVLALFIAPFAMAQNVGKVSYEFNEGDTIPLALSSININRLVVKNDRI
LSIVCPKGFCTSSGNQKDASGSITLKINIALPFTAHLTTEKGRLFALFITPKSTPALVTEFVWSESYKEQ
KSPIALAADYPAAMTALTKSMMRFVHDGSPIAGFKRHDVDPKTLPKDEAKLAIIPQTVFVGSDYSGVIYQ
LKNQGTQDIPLTTAQFYSDSARSAALDAYHLKPGQTTTLYLITGGGAAHVR
 
Nucleotide Sequence: 786 bp     [Download]
>gi|153971581|ref|NC_009702.1|:21555-22340 Vibrio vulnificus pC4602-1 plasmid
ATGAATCTCCATAAGCAATCATTACCCCCACAACCAAGATGGCACAGCCACCTCGTATCAATCACCTTGG
TGTTGGCGTTGTTTATCGCTCCCTTTGCCATGGCGCAGAACGTGGGCAAAGTCAGCTATGAGTTTAATGA
AGGTGACACCATACCCTTGGCACTCTCTTCGATTAATATCAACCGATTAGTGGTGAAAAATGACCGCATC
CTTTCGATTGTCTGCCCAAAAGGATTTTGTACCTCATCAGGCAACCAAAAAGACGCCTCTGGCTCTATCA
CCTTAAAAATTAACATTGCCTTACCGTTTACCGCGCACCTTACCACGGAAAAAGGACGCTTATTTGCCTT
GTTTATCACCCCAAAATCCACGCCAGCTCTCGTTACTGAGTTTGTCTGGTCTGAGAGTTACAAAGAGCAG
AAAAGCCCCATAGCGCTCGCAGCAGATTATCCCGCAGCCATGACAGCACTCACCAAATCGATGATGCGCT
TTGTTCACGATGGCTCACCCATTGCGGGATTTAAACGCCACGATGTCGATCCCAAAACGCTGCCAAAGGA
TGAGGCCAAATTGGCCATCATCCCTCAAACCGTCTTTGTTGGCAGCGATTACTCTGGCGTCATTTACCAA
CTCAAAAATCAAGGCACTCAAGATATCCCCCTCACGACGGCGCAGTTTTACAGCGATTCCGCTCGCTCAG
CCGCGCTCGATGCCTACCACTTGAAACCAGGACAAACCACGACGCTCTATCTCATTACTGGAGGAGGTGC
CGCTCATGTTCGATAA
 Primer design