SecReT4
Protein ID: 153971620
T4SS name [ID]Tra_F [515]
Gene symboltraB
Locus tagpC46021_06
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]22330..23862 [+]
Productputative conjugative transfer protein TraB
Component typeTraB_F
UniProt IDA7DVH0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.4e-35, Aligned region: 245..444
Protein Sequence: 510 a.a.     [Download]
>gi|153971620|ref|YP_001393138.1| putative conjugative transfer protein TraB [Vibrio vulnificus]
MFDKQRNHFDGLKKRFFKDTDGDFEEGGEVNAATQKRNRSITFIALTVVSVIAFAVWRFTLPAEPQEAQQ
ETVGFGAIVTDDFTDKDNQSALTFQQDKINQLEQSLTKFEGTLNRFGESLQSELENIKTTSKRNQESQLA
GLEQQMQQKLDEIEALKAQLETQLTENLNAQSHQSTANSAQGDTFGQYRLPPRASIDNNVDASNINEFTY
QRQDDVAFSGDAFDSFEFHWQASIDEKKSRRTTDNYVPTGTFVTAVVTGGADANAGVSGQGDTSPIVFQT
VNQGILPNGKKSKLDNCTITGAVYGEISSSRGIARTNRMSCIQDNGDILDIPVNATVFNFGRNGIRGTTI
LKNGKIVQMAGIAGILEGLGDAGKALAQTTTPTALGPSQSVDADKVGLSLLGGATESVGSKLADYYIKLA
ELYHPIVEVNPGAVVNIVFLEGFPLDPLLAEEYETRIQAQREQVSSTNQILDVITNAPALPQVNQTAPIN
PLAQKLTQQGLNSVGFGREE
 
Nucleotide Sequence: 1533 bp     [Download]
>gi|153971581|ref|NC_009702.1|:22330-23862 Vibrio vulnificus pC4602-1 plasmid
ATGTTCGATAAACAAAGAAACCACTTTGACGGACTTAAAAAACGGTTTTTTAAAGACACTGATGGTGACT
TTGAAGAGGGGGGAGAGGTAAATGCCGCCACACAAAAGCGTAACCGCAGCATCACGTTTATTGCTCTGAC
AGTCGTTAGCGTGATTGCCTTTGCGGTTTGGCGATTCACCTTACCGGCTGAACCTCAAGAAGCTCAACAG
GAAACGGTCGGTTTTGGTGCTATCGTGACCGATGACTTCACCGATAAAGACAATCAATCTGCCCTCACCT
TTCAGCAAGATAAAATCAATCAGCTTGAGCAAAGCTTGACCAAGTTTGAAGGGACACTCAACCGTTTTGG
TGAAAGCTTACAGTCTGAGCTTGAGAACATCAAAACCACCTCTAAGCGCAATCAAGAATCGCAGCTCGCC
GGACTAGAACAGCAGATGCAGCAAAAGCTCGATGAAATTGAGGCGCTTAAAGCCCAACTTGAGACACAAC
TTACCGAAAACCTCAATGCGCAAAGCCACCAAAGCACTGCAAATTCCGCCCAGGGCGATACCTTTGGACA
ATATCGTCTGCCACCAAGGGCGAGCATTGATAACAATGTGGATGCGAGCAATATCAATGAGTTCACCTAC
CAAAGACAAGATGACGTCGCCTTTAGTGGTGATGCGTTTGATAGCTTTGAATTTCATTGGCAAGCCAGCA
TCGATGAGAAAAAATCCCGTCGAACAACCGATAATTATGTCCCAACCGGCACCTTTGTTACCGCCGTGGT
GACAGGCGGTGCGGATGCGAATGCGGGCGTATCTGGCCAAGGGGACACCTCACCCATTGTCTTTCAAACC
GTCAATCAAGGCATTTTACCCAATGGTAAAAAGTCCAAGCTAGACAACTGTACGATTACAGGGGCCGTCT
ACGGTGAAATTTCATCCAGTCGCGGTATTGCACGAACGAACCGTATGAGCTGCATTCAAGATAACGGCGA
TATCTTAGACATCCCCGTTAATGCCACCGTGTTTAACTTTGGCCGTAACGGCATCCGAGGCACCACCATT
TTGAAAAACGGCAAAATTGTTCAAATGGCGGGCATTGCAGGCATCTTGGAAGGTTTAGGGGATGCGGGTA
AGGCGCTGGCACAAACCACCACACCAACCGCACTTGGCCCAAGTCAAAGTGTGGATGCAGATAAGGTCGG
ATTAAGCCTACTTGGCGGCGCAACAGAAAGTGTGGGCAGTAAGCTTGCTGACTACTACATCAAGCTCGCC
GAGCTTTATCACCCCATTGTCGAAGTCAATCCAGGCGCAGTCGTGAACATCGTCTTCTTAGAAGGGTTTC
CGCTTGACCCACTCCTAGCTGAGGAATATGAAACGCGCATTCAAGCTCAGCGCGAACAAGTCTCTAGTAC
CAATCAGATACTTGATGTCATCACCAATGCGCCAGCTCTACCCCAAGTTAACCAAACTGCCCCCATCAAC
CCATTAGCACAAAAGCTCACCCAACAAGGGCTAAATAGCGTGGGCTTTGGGCGCGAGGAATAA
 Primer design