SecReT4
Protein ID: 153971622
T4SS name [ID]Tra_F [515]
Gene symbolvpa41
Locus tagpC46021_50
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]24273..26822 [+]
Productputative conjugative transfer protein TraC
Component typeTraC_F
UniProt IDA7DVH2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 9.6e-49, Aligned region: 21..254
AAA_10 [PF12846], Evalue: 6.6e-43, Aligned region: 454..745
TrwB_AAD_bind [PF10412], Evalue: 7.4e-06, Aligned region: 451..516
Protein Sequence: 849 a.a.     [Download]
>gi|153971622|ref|YP_001393140.1| putative conjugative transfer protein TraC [Vibrio vulnificus]
MLSRTSSGLSALFQEAKRAQNHLHHELPYRDYDPIERVFENTHSRGFGFKLSVLGGANDDLIQSLSHLIG
DLPEGDKWDYQVQLFGHNRVAHYLEGNQAQLSQRGGICQKMANDDAIYAHYAAQHGFLHRQKNNRFDLRD
HDAFFFVSTTEKDPQELLDARLTLETGLAQLGFDLLPVTPEMLLTSVGDILNFDKRQDRPIEKSYNPLEP
LNLQALSPDTEALTYRGHIATRHTNHQGKDVQTQIVNMGLSRLPGDYRLYALPEAFSSIRNVSRNITCPY
RVTLNFRNEPTGKQNADNDNKIKDLNKTVNSQMALLAPTAEDELKERKALQKGLLSKEFTIASMVLTVTL
FTDKDNQKKDTQAAKESFSNAGLDIIPLKMNQPQALLSTLPFMMSEGLWQDCKKAGRVRTLKSSNLVNFL
PLIMDFCQLKGGVLLPTMRQQISFFNPFTCGSDNQNIALTGGSGAGKSFFVQEMAEVIYAMGGKVWILDK
GSSYKKLTLSLGGTYMTHANIFLNPFTHLGSIQNAEFEFVDDDGHAVDPMMEALDNITALFATIASPYAP
LTAFQQSVLGDAIVTAWERKGNQALVDDVRDALIEIAGIDSDRRIKDIAVQLKKFCSDGMYKEVFNKPSM
LDPKVEITTLELDGFPPAVLRPVIFALMVSINQQMYLSGSRSTPKLCIIEEAWSLLSGANEQAREFINTG
YRTARKFGGAFCTVTQGIEDFFSSEEAKACYNNSDIHIILRQGEGFDKYLAQNPSAFSPYEQRIIKSFDK
SSTAGYSCARIKAGGHVTYHRFFASPVKRAMFSTEPKEFEYCENLYKQGMALEEAIEQTSMHFYGKEIEA
FNQAIGASA
 
Nucleotide Sequence: 2550 bp     [Download]
>gi|153971581|ref|NC_009702.1|:24273-26822 Vibrio vulnificus pC4602-1 plasmid
ATGCTTTCACGTACTAGCAGTGGCCTTTCTGCCTTATTCCAAGAGGCGAAACGCGCCCAAAACCACCTCC
ACCATGAATTGCCCTATCGAGACTATGACCCCATTGAACGCGTCTTTGAAAACACACATTCTCGTGGGTT
TGGCTTTAAACTCAGCGTTCTAGGCGGTGCTAATGATGATCTTATTCAGTCACTTAGCCACCTTATTGGT
GATTTACCCGAAGGTGACAAATGGGATTATCAAGTACAACTGTTTGGCCATAACCGTGTCGCGCACTACT
TAGAGGGGAATCAAGCCCAACTCAGTCAGCGCGGGGGAATTTGTCAAAAGATGGCCAATGACGATGCCAT
TTACGCGCACTACGCCGCGCAGCATGGCTTTTTGCATCGACAAAAAAACAATCGTTTCGACTTGCGCGAT
CATGATGCGTTCTTTTTTGTCTCCACCACGGAAAAAGATCCACAAGAGCTTCTCGATGCGCGCCTCACCC
TTGAAACAGGTCTGGCGCAACTTGGGTTTGATTTACTGCCCGTCACCCCAGAAATGTTGCTCACCAGTGT
GGGCGACATTTTGAACTTTGATAAGCGGCAAGACCGCCCAATAGAAAAAAGTTACAACCCCTTAGAGCCG
TTAAACCTACAGGCGTTATCACCCGATACAGAAGCGCTCACCTATCGCGGTCATATTGCCACTCGGCATA
CCAACCACCAAGGAAAAGACGTTCAAACCCAGATAGTGAACATGGGCCTGTCAAGGTTGCCAGGGGATTA
TCGACTCTATGCGCTACCAGAGGCATTTTCTTCTATTCGCAACGTGTCGCGGAACATTACGTGTCCGTAC
CGAGTCACGCTGAATTTTCGTAATGAGCCAACCGGTAAACAAAACGCCGACAACGACAACAAAATTAAAG
ATCTCAACAAAACCGTGAACAGCCAAATGGCGCTGCTCGCACCGACCGCAGAAGATGAACTCAAAGAGCG
CAAAGCTCTGCAAAAAGGATTGCTCTCAAAAGAGTTTACCATTGCGTCAATGGTACTGACCGTCACCCTA
TTTACCGACAAGGACAACCAAAAAAAAGACACACAAGCGGCGAAAGAGTCGTTCAGCAATGCAGGACTCG
ATATCATCCCGCTAAAAATGAATCAGCCACAAGCCCTGCTCTCCACGCTGCCTTTTATGATGAGTGAAGG
CTTATGGCAAGATTGTAAAAAAGCCGGTCGAGTGCGCACATTAAAAAGCTCCAACCTGGTGAACTTCTTG
CCGCTCATCATGGATTTTTGCCAACTCAAAGGAGGGGTACTCCTTCCCACAATGCGCCAGCAAATCTCGT
TCTTTAATCCCTTTACCTGTGGAAGTGACAACCAAAACATTGCACTCACCGGAGGCTCTGGGGCAGGAAA
AAGCTTTTTTGTTCAGGAAATGGCAGAAGTCATCTACGCCATGGGCGGTAAAGTGTGGATACTCGATAAA
GGCTCCAGTTACAAAAAGCTAACGTTAAGCCTCGGCGGCACTTACATGACGCACGCCAATATCTTTTTAA
ATCCCTTCACGCATTTGGGCTCGATACAAAATGCAGAGTTTGAGTTTGTTGATGACGACGGCCACGCCGT
TGACCCTATGATGGAAGCACTCGACAACATCACCGCCCTCTTTGCCACCATCGCCTCCCCTTATGCACCA
CTAACGGCGTTTCAACAAAGCGTGCTTGGCGACGCCATCGTTACGGCGTGGGAGCGAAAAGGTAATCAAG
CGTTAGTGGACGATGTCAGAGACGCCTTGATTGAGATTGCCGGCATCGATTCCGACCGGCGCATTAAAGA
CATCGCGGTGCAACTGAAAAAATTCTGTAGTGATGGGATGTATAAAGAGGTCTTTAACAAACCGTCGATG
CTCGATCCTAAAGTGGAAATCACCACCCTAGAGTTAGATGGCTTCCCGCCAGCGGTACTTCGTCCAGTGA
TTTTCGCCCTGATGGTGTCTATCAATCAGCAAATGTACCTATCTGGCTCTCGTTCCACACCTAAGCTGTG
CATCATTGAAGAGGCGTGGAGCTTACTGTCTGGGGCAAACGAGCAAGCCCGTGAGTTCATCAACACAGGC
TATCGCACCGCCCGTAAGTTCGGAGGGGCTTTCTGCACGGTCACTCAAGGGATTGAGGACTTCTTTAGCA
GTGAGGAGGCGAAAGCCTGTTACAACAACTCTGATATCCACATCATTCTTCGCCAAGGGGAAGGGTTTGA
TAAATACCTAGCGCAAAACCCATCCGCGTTTAGCCCTTACGAACAACGCATCATCAAAAGTTTTGATAAG
TCTTCCACCGCAGGATACAGCTGCGCCCGCATCAAAGCTGGCGGTCACGTGACCTATCACCGCTTTTTTG
CTTCCCCCGTCAAACGGGCCATGTTTTCAACCGAGCCCAAGGAGTTTGAATACTGTGAAAATCTTTACAA
ACAAGGCATGGCACTGGAAGAGGCCATTGAGCAAACGTCCATGCATTTCTACGGCAAAGAAATTGAAGCC
TTTAATCAAGCGATTGGCGCGAGCGCTTAG
 Primer design