SecReT4
Protein ID: 153971623
T4SS name [ID]Tra_F [515]
Gene symboltraW
Locus tagpC46021_17
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]26785..27504 [+]
Productputative conjugative transfer protein TraW
Component typeTraW_F
UniProt IDA7DVH3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 7e-10, Aligned region: 14..43
Protein Sequence: 239 a.a.     [Download]
>gi|153971623|ref|YP_001393141.1| putative conjugative transfer protein TraW [Vibrio vulnificus]
MKPLIKRLARALSSLPFILVAGMVTFNAYAKELGQVAPVFPIGEIDMLEWIDHRLKQFEANGKLADMQEE
FTERVKKSIENPPPVEGLMTTTNPRTFYADPSITIPKDITIPATGQVIAKAGTKVNPFDSRTWPKVDGKD
VLPRFELSKVLVFFDARDAQQRRFASEYQNPKPIKWILTGGSPNQMATLLDARIYFAQDGFLTERLSITH
VPAIAYQEGTRWRIDEVDVSGLPPLEIEP
 
Nucleotide Sequence: 720 bp     [Download]
>gi|153971581|ref|NC_009702.1|:26785-27504 Vibrio vulnificus pC4602-1 plasmid
TTGAAGCCTTTAATCAAGCGATTGGCGCGAGCGCTTAGCTCGCTGCCTTTCATCCTTGTGGCGGGCATGG
TCACTTTTAACGCTTACGCGAAAGAATTGGGGCAAGTTGCCCCTGTCTTTCCTATTGGTGAAATTGACAT
GCTTGAATGGATTGACCACAGGCTGAAACAATTTGAAGCCAATGGCAAACTGGCTGACATGCAAGAGGAA
TTTACCGAGCGAGTTAAAAAAAGCATTGAAAACCCGCCACCGGTTGAAGGCTTAATGACCACCACCAACC
CTCGCACCTTTTACGCAGACCCAAGCATCACCATCCCGAAAGACATCACCATCCCCGCCACCGGCCAAGT
CATTGCCAAAGCGGGCACTAAGGTCAATCCCTTTGACAGCCGAACTTGGCCAAAGGTCGATGGTAAAGAC
GTTTTACCTCGATTTGAACTCAGCAAGGTGCTGGTCTTTTTTGATGCAAGAGACGCACAGCAAAGGCGCT
TTGCCAGTGAGTACCAAAACCCAAAACCCATAAAGTGGATACTGACTGGAGGCAGCCCAAACCAAATGGC
AACCTTACTCGATGCCAGAATATACTTTGCACAAGACGGCTTTTTAACCGAAAGGCTCAGCATCACTCAC
GTCCCCGCGATTGCTTATCAAGAAGGGACGCGCTGGCGCATCGATGAAGTGGATGTATCGGGTTTACCAC
CGTTGGAGATCGAACCATGA
 Primer design