SecReT4
Protein ID: 153971624
T4SS name [ID]Tra_F [515]
Gene symboltraU
Locus tagpC46021_16
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]27501..28511 [+]
Productputative conjugative transfer protein TraU
Component typeTraU_F
UniProt IDA7DVH4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 4.6e-82, Aligned region: 31..335
Protein Sequence: 336 a.a.     [Download]
>gi|153971624|ref|YP_001393142.1| putative conjugative transfer protein TraU [Vibrio vulnificus]
MTQRYLPLLLCCLLVFIAPPTLADSAACKSRFINPITDICWDCLFPMTIGSATVMPSKYPDTNNPASPIS
YCPKPPPVFVQIGVNIGYWEPYALTDITRVPYCMVNMGTQMSGANSQRVGGRVTARDNDSSDGGFYHAHW
YKYPVIYWLQLMQSTACMATDNFDVAYMTEIDPLWDDDELSLILNPEALLFGNLIAQLACVPEAMLTSTN
LVLPIDALFWCLGSQGSAYPLTGTTNYRDTPIQAATLLMEKLNYKLHRQGIVWETRGEDGAICYQYPDPI
LPKSRYRYQMSSPIPDAAWCHPYTTTTTLWEAGHDNPVTGDNFGFVQWRKRNCVFL
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|153971581|ref|NC_009702.1|:27501-28511 Vibrio vulnificus pC4602-1 plasmid
ATGACACAGCGATACTTACCTTTACTACTGTGCTGCTTATTGGTGTTTATTGCGCCACCCACCTTAGCTG
ACAGCGCGGCGTGCAAAAGCCGCTTTATCAACCCTATCACAGACATCTGTTGGGATTGCTTATTTCCCAT
GACCATCGGCTCGGCCACCGTCATGCCCTCGAAATATCCCGACACCAACAACCCCGCCTCACCGATTTCT
TATTGTCCAAAGCCCCCACCGGTCTTTGTGCAAATAGGGGTCAATATTGGTTATTGGGAGCCCTACGCTT
TAACGGACATTACCCGCGTTCCTTATTGCATGGTCAACATGGGTACGCAAATGTCAGGGGCAAACAGTCA
GAGAGTGGGTGGACGAGTGACCGCTCGCGACAATGACAGCAGTGACGGCGGCTTTTATCATGCCCATTGG
TACAAATACCCCGTCATTTACTGGTTACAACTGATGCAATCCACCGCTTGTATGGCCACCGACAATTTTG
ACGTCGCTTACATGACTGAAATCGATCCACTTTGGGATGATGATGAACTGTCGCTCATTCTCAACCCAGA
AGCCTTACTTTTTGGTAACTTGATTGCACAGCTCGCTTGTGTTCCTGAAGCCATGCTCACTTCGACGAAC
CTTGTCCTCCCTATCGATGCGCTCTTTTGGTGCTTGGGCTCACAAGGCAGTGCCTATCCCCTGACTGGCA
CAACAAACTATCGGGATACACCCATTCAGGCGGCAACGCTGTTGATGGAAAAACTGAACTACAAGCTTCA
CAGGCAAGGCATCGTCTGGGAAACGCGCGGTGAAGACGGGGCGATTTGTTATCAATATCCAGATCCCATT
TTGCCAAAATCCCGCTACCGCTATCAAATGTCATCACCCATCCCTGACGCGGCATGGTGCCACCCTTATA
CGACCACCACCACCTTGTGGGAAGCGGGACACGACAACCCCGTCACCGGAGATAACTTTGGGTTTGTTCA
GTGGCGAAAACGTAACTGTGTATTTTTGTAA
 Primer design