SecReT4
Protein ID: 153971626
T4SS name [ID]Tra_F [515]
Gene symbolvpa45
Locus tagpC46021_52
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]28768..29481 [+]
Productputative conjugative transfer protein TrbC
Component typeTrbC_F
UniProt IDA7DVH6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 2.8e-31, Aligned region: 106..218
Protein Sequence: 237 a.a.     [Download]
>gi|153971626|ref|YP_001393144.1| putative conjugative transfer protein TrbC [Vibrio vulnificus]
MKAPSFESALWRSLLFLCLVVSLPSHAYTEEELKAFAKLEQELSQQTSGINPLGLEQVQNQASAYQQEAL
DASRKIQALVKEESLSPLLGIQKPTRNPDQAPKGVMVFVSLTMPENALKQLLMQSEHLGVPLVIRGVLPE
GFPATAKRIESLIRSPNKAPIQSGFSISPDWFKQFGITKVPAFVSVKPGRCLPEQPCAITDYDILYGNIS
LYQALDYLADGDAQQNVLPLLHTLYSQ
 
Nucleotide Sequence: 714 bp     [Download]
>gi|153971581|ref|NC_009702.1|:28768-29481 Vibrio vulnificus pC4602-1 plasmid
ATGAAAGCACCATCGTTTGAGAGCGCCCTTTGGCGCTCTCTCCTTTTTCTGTGCTTGGTGGTTTCACTGC
CAAGCCACGCTTATACAGAAGAAGAACTCAAAGCGTTTGCCAAGCTTGAGCAAGAACTCAGCCAGCAAAC
CAGCGGGATCAATCCGCTAGGTCTTGAACAAGTGCAAAATCAAGCCAGCGCCTATCAACAGGAAGCGCTG
GATGCCAGCCGAAAAATCCAAGCCCTGGTGAAAGAGGAAAGCCTCTCTCCACTGCTCGGCATTCAAAAGC
CAACACGCAATCCAGACCAAGCGCCCAAAGGAGTGATGGTCTTTGTGTCACTGACTATGCCAGAGAACGC
GCTCAAACAGCTCTTAATGCAAAGCGAGCATCTCGGCGTCCCTCTTGTGATTCGCGGTGTCTTACCCGAA
GGGTTTCCCGCTACCGCCAAACGCATCGAGTCATTGATACGCTCACCCAATAAAGCCCCCATTCAGAGCG
GATTTTCCATCAGCCCAGATTGGTTTAAGCAGTTTGGCATCACCAAAGTGCCAGCCTTTGTGTCAGTAAA
ACCAGGTCGTTGCCTACCTGAGCAGCCTTGCGCCATCACGGACTACGACATTCTTTACGGTAACATTTCG
CTTTATCAAGCGCTGGATTACCTCGCCGATGGGGACGCGCAGCAAAACGTTCTGCCTCTACTGCACACCC
TGTATTCACAATAG
 Primer design