SecReT4
Protein ID: 153971627
T4SS name [ID]Tra_F [515]
Gene symboltraN
Locus tagpC46021_15
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]29518..31242 [+]
Productputative conjugative transfer protein TraN
Component typeTraN_F
UniProt IDA7DVH7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 8.7e-79, Aligned region: 296..532
Protein Sequence: 574 a.a.     [Download]
>gi|153971627|ref|YP_001393145.1| putative conjugative transfer protein TraN [Vibrio vulnificus]
MRLYFWTALALSLFCTLAFADDQQTFTDSANWAKQTASQALTPNALPLNIDEYCADATCRRDIRAPKEAN
LSDSDINAQKGAAFASNEVAQSINANFNQGRPDIKNDPALRFALLGQENAFEITHGISNQYVDCNTGQQC
LQKSTPRVCNMPTNNAVPCLKTPSATVITSTVFEGCNEGWSREGRECKLVTEQCKFDHLHYIEVGKNWSN
IGSFWNGVRIDRRPIGPKWIKASDGNYYRQGERAIWGSYGGRLEICKQEIDITPLILTCEEGFSLSGGNC
IKNTFSWKTECSLIKNCQMTHETCIEGKETRIVNGIPETLDCWKYQSFYQCQMTDTCQSLPSECETVKTQ
CRLKQNGVCVEQEVTKNCFEKSCRTTQMQCGEQSFCLDGDCYTEEPKLNGNFDKSVAALAGLSEAVKDIG
DPPQIFTGKPMKCDKKLAGFNDCCKDSGWGQNLGAKCSEAEEALGKAKEKGLTLYVGEYCASKVLGVCTR
KKRSYCVYDSKLAKIIQEQGSIGQLGKGLGSAKNPTCAAITPEELGQINFEYIDFQEFYPEMHANAQLPN
FDEIKKRLQSATGN
 
Nucleotide Sequence: 1725 bp     [Download]
>gi|153971581|ref|NC_009702.1|:29518-31242 Vibrio vulnificus pC4602-1 plasmid
ATGCGCCTGTATTTTTGGACTGCGCTCGCGCTCAGCCTGTTTTGCACTTTGGCGTTCGCCGACGACCAAC
AAACCTTTACCGACAGCGCCAATTGGGCAAAGCAAACCGCGAGTCAAGCGCTCACACCCAATGCGTTGCC
GCTCAATATCGATGAATATTGTGCCGATGCAACCTGCCGCCGAGATATCCGCGCGCCTAAAGAAGCAAAC
CTGTCTGACAGTGACATCAACGCCCAAAAAGGCGCGGCCTTTGCAAGCAATGAGGTTGCGCAAAGCATCA
ACGCCAATTTCAACCAAGGCCGACCCGACATCAAAAACGATCCTGCATTGCGCTTTGCCCTACTCGGCCA
AGAAAATGCCTTTGAAATTACCCATGGCATTTCAAACCAATACGTCGATTGCAATACGGGTCAGCAATGC
TTACAGAAAAGCACGCCAAGGGTCTGCAATATGCCAACCAACAATGCTGTCCCCTGCCTCAAAACGCCGT
CCGCCACGGTCATAACCTCGACGGTTTTTGAAGGATGTAACGAGGGATGGAGTCGAGAGGGTAGAGAATG
CAAGCTTGTGACAGAGCAGTGCAAATTCGACCACCTCCACTACATTGAAGTTGGTAAAAACTGGTCAAAC
ATAGGCTCCTTTTGGAATGGCGTGCGCATTGATAGAAGACCAATCGGACCAAAGTGGATAAAAGCTTCTG
ACGGAAACTACTACAGGCAAGGCGAACGAGCGATATGGGGCTCTTATGGGGGGCGGCTAGAAATATGCAA
ACAAGAGATTGATATTACCCCTCTCATTTTGACTTGCGAGGAAGGGTTCTCTTTATCTGGGGGGAACTGC
ATAAAAAATACGTTCTCTTGGAAAACAGAATGCTCCTTAATCAAAAATTGCCAAATGACCCATGAAACTT
GTATTGAAGGAAAAGAAACCCGCATCGTCAATGGCATCCCTGAGACACTAGACTGCTGGAAATACCAATC
ATTTTATCAATGCCAAATGACCGATACTTGCCAGTCTTTACCTAGTGAATGTGAAACCGTAAAAACGCAG
TGTCGTCTTAAGCAAAATGGCGTGTGTGTTGAGCAAGAGGTAACAAAGAACTGTTTTGAAAAATCGTGTC
GCACCACTCAAATGCAATGTGGCGAACAATCTTTTTGTCTTGATGGTGATTGCTATACAGAGGAGCCCAA
ACTCAATGGCAACTTTGATAAATCTGTCGCGGCATTAGCGGGGCTTTCCGAAGCCGTCAAAGACATTGGC
GACCCGCCACAAATCTTTACGGGTAAACCCATGAAGTGCGACAAAAAACTCGCCGGCTTTAACGACTGCT
GCAAAGACTCGGGTTGGGGTCAAAATCTGGGTGCAAAATGCAGCGAAGCCGAAGAAGCACTAGGCAAGGC
TAAAGAGAAAGGATTAACCCTCTACGTTGGGGAATATTGTGCAAGCAAAGTCCTGGGCGTTTGCACTCGT
AAAAAGCGCAGCTACTGCGTTTATGACAGCAAGCTAGCCAAAATTATTCAAGAGCAAGGGTCTATCGGGC
AATTAGGGAAAGGACTTGGCAGTGCCAAAAACCCCACATGCGCCGCGATAACACCCGAAGAATTAGGGCA
AATCAACTTTGAGTACATCGACTTTCAAGAGTTTTACCCAGAGATGCACGCCAACGCCCAACTCCCTAAC
TTTGATGAAATCAAGAAGCGACTTCAAAGCGCAACGGGCAATTAA
 Primer design