SecReT4
Protein ID: 153971628
T4SS name [ID]Tra_F [515]
Gene symboltraF
Locus tagpC46021_09
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]31290..32069 [+]
Productputative conjugative transfer protein TraF
Component typeTraF_F
UniProt IDA7DVH8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 4.1e-67, Aligned region: 28..248
Protein Sequence: 259 a.a.     [Download]
>gi|153971628|ref|YP_001393146.1| putative conjugative transfer protein TraF [Vibrio vulnificus]
MKKRPLYVIPLVLLIQVYPTLANETPPGWRWYNEPKTALQAPKVEPLPSNTQTTISSPKTLSATEQMDWF
HTMHKEAQNDAAIHPKDKEKLARFLALNRFITDQTDQLGMTFKALLLEKPELSYTKEHPTEQAARQVYLD
LENQKKTDAVEKMKREGWGFFFVYDGKDKLSQQLAPSIQAFADQYHFELLGISNDETFITNITVNRHNQG
KISVPFTPALILVHPSTGEMKPLAYGWISQNELLGRFYNVATNFEQSDF
 
Nucleotide Sequence: 780 bp     [Download]
>gi|153971581|ref|NC_009702.1|:31290-32069 Vibrio vulnificus pC4602-1 plasmid
ATGAAAAAAAGACCACTTTACGTCATTCCCCTAGTGCTGCTTATTCAAGTCTATCCCACTCTGGCCAATG
AAACACCGCCAGGGTGGCGATGGTACAACGAGCCAAAAACCGCGCTTCAAGCGCCTAAAGTTGAACCACT
ACCAAGCAACACACAAACCACCATATCAAGCCCTAAAACCTTGTCAGCGACCGAACAAATGGATTGGTTC
CATACCATGCACAAGGAGGCACAAAACGACGCCGCCATCCACCCCAAAGACAAAGAAAAACTGGCCAGAT
TCCTAGCGCTTAATCGATTTATTACCGACCAAACCGATCAGTTAGGCATGACCTTTAAGGCTTTACTACT
GGAAAAACCGGAGCTCTCTTACACCAAAGAGCACCCGACCGAGCAAGCCGCAAGACAAGTGTATCTCGAT
CTCGAAAACCAAAAGAAAACCGATGCCGTTGAAAAGATGAAGCGAGAAGGCTGGGGTTTTTTCTTTGTCT
ATGACGGCAAAGACAAGCTCAGCCAGCAACTTGCCCCATCCATTCAAGCCTTTGCCGACCAATACCACTT
TGAACTCCTTGGGATCAGCAATGATGAAACCTTCATCACGAACATCACCGTAAACCGCCACAACCAAGGC
AAGATTTCGGTGCCGTTTACCCCCGCATTGATTTTAGTGCACCCAAGCACTGGAGAGATGAAGCCACTGG
CGTATGGCTGGATAAGCCAAAACGAGTTACTTGGGCGTTTTTACAACGTCGCGACCAACTTTGAACAATC
CGATTTTTAG
 Primer design