SecReT4
Protein ID: 153971630
T4SS name [ID]Tra_F [515]
Gene symboltraH
Locus tagpC46021_11
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]32497..33903 [+]
Productputative conjugative transfer protein TraH
Component typeTraH_F
UniProt IDA7DVI0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 3e-117, Aligned region: 38..392
Protein Sequence: 468 a.a.     [Download]
>gi|153971630|ref|YP_001393148.1| putative conjugative transfer protein TraH [Vibrio vulnificus]
MRRSLTHHLSTISVHKRFIPLLFIALPAISHADTNNALARFFDNSGYNANVSNPSAYQGQSANYYTGGSL
FVRTPIVDAQLVSVTVPSISAGCSGIDMFMGGFSHVSSDQLVKVGKAIIHNAPPFIVNLALQTWAPQLKQ
NLDNLQAIADKYLNQSVNSCEAAQAAIGGLAAFAAPATKKHVCATLGTQNNAFSDWVQAQHECGAGGKAA
GQLANAKNDPALKDITKTNHNVVWSAIMNNAFLSADKHLAQFMMSLSGTYVYDANGNPRYYPSLLTDNNN
LVNVLLEGGKADIYQCRSTDPKACITITKPNNLSISQANGIQSQISKQLESILRHIATDQKLTDKQKSFL
ELTQTPVLKFFMDDLSANQTPDINSYARMIAVELLNQYLTNMLSIASQSLANTNNSVEDIALITRDIDNA
KRFTTGLADKAIETLNQRNQLIESQRKTAQRSQKDIGITTKPTQAYGN
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|153971581|ref|NC_009702.1|:32497-33903 Vibrio vulnificus pC4602-1 plasmid
ATGAGGCGCTCACTTACTCACCACTTATCCACCATTTCGGTGCATAAGCGGTTTATTCCTTTATTGTTCA
TTGCGTTACCCGCAATAAGTCACGCTGACACCAACAACGCACTTGCACGCTTTTTTGATAACTCTGGTTA
TAACGCGAACGTCTCTAACCCTAGCGCCTACCAAGGCCAATCTGCCAACTACTACACAGGGGGAAGCTTG
TTTGTGCGCACCCCCATCGTTGACGCGCAATTGGTCAGTGTCACCGTCCCTTCTATCAGTGCGGGCTGTT
CGGGGATTGACATGTTTATGGGGGGGTTCTCTCATGTCAGTTCGGATCAACTGGTGAAAGTGGGGAAAGC
CATTATCCACAACGCCCCTCCCTTTATTGTCAATCTGGCTTTGCAAACCTGGGCTCCACAGCTCAAACAA
AACCTCGATAATCTGCAAGCCATTGCCGACAAATACTTAAACCAGTCCGTGAACTCTTGTGAAGCTGCGC
AAGCCGCCATCGGTGGACTCGCCGCCTTTGCCGCGCCCGCCACCAAAAAGCATGTTTGTGCCACGCTCGG
GACACAAAACAATGCGTTCTCGGATTGGGTACAAGCTCAGCATGAATGTGGGGCAGGAGGCAAAGCCGCC
GGTCAACTGGCGAATGCGAAAAACGATCCTGCGCTGAAAGACATCACCAAAACCAATCATAATGTGGTGT
GGTCGGCCATTATGAACAACGCGTTTTTATCGGCAGATAAACACCTCGCGCAATTTATGATGAGCTTATC
AGGGACATACGTTTACGATGCCAACGGCAACCCTCGCTACTACCCAAGTCTTTTGACCGATAATAACAAC
CTGGTCAACGTACTTTTGGAAGGTGGCAAAGCCGACATTTACCAATGCAGAAGCACCGACCCAAAAGCGT
GCATTACCATCACCAAACCCAACAACTTATCCATCAGCCAGGCCAACGGCATTCAAAGCCAGATAAGCAA
ACAACTGGAATCGATACTACGCCATATCGCGACTGACCAAAAACTGACGGATAAACAAAAGAGCTTTTTA
GAACTGACCCAGACACCGGTACTCAAATTTTTTATGGATGATCTGTCAGCCAATCAAACCCCCGACATCA
ACAGTTACGCACGCATGATAGCGGTAGAGCTACTTAATCAATACCTCACCAATATGCTGAGTATCGCCAG
CCAATCACTGGCTAATACCAATAACAGTGTCGAGGATATTGCCCTCATCACGCGCGATATCGATAACGCC
AAACGATTTACCACAGGACTTGCCGACAAAGCCATTGAAACACTTAACCAGCGCAACCAACTTATCGAGT
CACAACGAAAAACGGCGCAGCGCAGTCAAAAGGACATCGGCATCACCACGAAACCCACACAGGCTTATGG
GAACTAA
 Primer design