SecReT4
Protein ID: 153971631
T4SS name [ID]Tra_F [515]
Gene symboltraG
Locus tagpC46021_10
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]33907..36720 [+]
Productputative conjugative transfer protein TraG
Component typeTraG_F
UniProt IDA7DVI1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 4.4e-117, Aligned region: 4..459
Protein Sequence: 937 a.a.     [Download]
>gi|153971631|ref|YP_001393149.1| putative conjugative transfer protein TraG [Vibrio vulnificus]
MILEYYTYTSGEVVNKAFNALATFFKTNTFGDYLQMCMMLSLITSLFIFMLSRNPKDLIKWMVVFFAVPL
FLINMKADMLIIDKTQPGKAYKVDNVPYLVAVPTYFFSSIMVGMAEGVEAIFTTSDDERYGRTGMLFGSE
LYQLSRQSSVREIGLKKLWSDYFQNCMIGDVRINHKYTWDELFAAPNIFTFLDGIKQSPLRALYLDEGGG
KISYKLCEEAYPIVKQRFDAASNENVTLLAHHLLGKEANRYKPQIVQSLQRSYNKFFSISTSASNTIKQN
MLMNELRYNLDSLDPTQAALNYAYTTNKLQTTSMWASLGLMAREYLPMLHTMLFMLFACLGFFVAGAAVI
PGLTLMVLKNYLGTFAFLATWPALFAIINGFQLWGLESLSTDVSGKFGGLVLSNANAADELHSRFAWMTG
ILMIGVPLIAGGILKGGQSVMSSMNYQLSSMINSTNARASAAASTGNLDFGSMQIDNHSMNNTHANKFDT
NTLTNQGHRYTQNQDGSVTTQHGDGRTTYDSTQTVSRGNISTNTSAMLQESVANARSQTEQNLAQTSTQL
GQTIQAGAALNDRWHDCVGKNLSYGEGSTTGFNTQVSQGMSNMQSAIDNVSKQTGWSKDKSQAYLQSAYA
GVEAGVGTGKGKSPFNFGANAGVKWSDEERTAYSNMSSEQKQQLEQATKQYTEGANAVTTAGTQVDNKDT
RTSVEQFAHDFAINASNTKSLGASVMQSQSDLNALSNTQTRLESVGGSFTAKADGAFQNYLEKTVKLEQE
DVGRLMTAYQPEDIADAKKHWQEFTRTEAFATMAGLDGDSARVVAKMNQDHQATTPTMPPSLTPEQSKTM
ENEWEKTQGAVDATRTAVMHNKGTGGLFNQDRFDGVTDDAKQQQSQAQQSIAKPEPIIALTIKSQVEAEV
TKPERTEYVTSDQSYPAAPRYTQNPNK
 
Nucleotide Sequence: 2814 bp     [Download]
>gi|153971581|ref|NC_009702.1|:33907-36720 Vibrio vulnificus pC4602-1 plasmid
ATGATACTAGAGTATTACACCTACACCTCTGGCGAGGTGGTCAACAAAGCCTTTAACGCGCTGGCCACCT
TTTTCAAAACCAATACCTTTGGTGATTACTTACAGATGTGCATGATGCTGAGCCTTATCACCAGCCTGTT
TATCTTCATGCTCTCTCGTAACCCCAAAGACCTCATCAAATGGATGGTGGTTTTCTTCGCCGTGCCATTG
TTTCTGATCAACATGAAAGCCGACATGCTCATCATTGATAAAACTCAACCAGGAAAAGCGTACAAAGTCG
ATAACGTACCCTACCTTGTCGCTGTACCGACTTACTTTTTCTCGTCGATCATGGTCGGGATGGCTGAGGG
AGTGGAAGCCATTTTCACCACCTCCGATGATGAGCGTTATGGGCGTACTGGCATGTTGTTTGGTTCTGAG
CTCTATCAACTCTCAAGGCAATCCAGTGTGCGTGAAATCGGACTCAAAAAGCTCTGGAGTGATTATTTTC
AAAACTGCATGATTGGCGATGTCAGAATTAACCACAAATACACGTGGGATGAACTCTTTGCCGCTCCGAA
TATTTTTACCTTTCTCGATGGCATCAAACAAAGCCCGTTGCGCGCGCTCTACCTTGATGAAGGCGGCGGC
AAGATCAGCTATAAATTGTGTGAAGAAGCGTACCCCATAGTAAAACAACGCTTTGATGCGGCGTCGAACG
AAAACGTCACCTTGTTAGCGCATCATTTACTCGGCAAGGAGGCCAATCGCTACAAACCGCAAATCGTTCA
ATCGCTCCAACGCAGTTACAACAAATTCTTTTCCATCAGCACCAGCGCCTCCAACACGATTAAGCAAAAC
ATGTTGATGAATGAGCTTCGCTACAACCTAGACAGCCTTGACCCCACTCAAGCGGCGCTCAATTACGCCT
ATACCACCAACAAGCTGCAAACCACCTCGATGTGGGCCTCTCTCGGTTTAATGGCAAGGGAATACTTACC
CATGCTCCACACCATGCTGTTTATGCTCTTTGCTTGTTTGGGCTTTTTTGTTGCAGGCGCAGCGGTCATT
CCAGGATTAACCCTGATGGTACTGAAAAACTACCTTGGTACATTTGCCTTCCTGGCAACATGGCCAGCGC
TCTTTGCCATCATCAATGGCTTCCAGTTATGGGGACTGGAATCCTTATCCACGGATGTCTCCGGTAAATT
TGGTGGACTGGTTCTCTCCAATGCCAATGCCGCCGATGAACTTCACAGCCGCTTTGCCTGGATGACTGGC
ATTTTGATGATAGGCGTGCCGTTAATTGCCGGTGGCATACTCAAAGGCGGGCAATCGGTCATGTCGAGCA
TGAACTACCAGTTATCAAGTATGATTAATTCCACCAACGCCAGAGCGAGCGCAGCCGCCTCAACCGGTAA
TCTGGACTTTGGCAGTATGCAAATTGATAACCACAGCATGAACAACACCCATGCCAATAAGTTTGATACC
AACACACTGACCAACCAAGGGCATCGTTACACCCAAAACCAAGATGGCTCGGTAACAACGCAACATGGCG
ATGGACGTACCACCTACGACAGCACACAAACGGTCAGCCGAGGTAATATCTCCACTAATACTTCCGCCAT
GTTGCAAGAAAGCGTGGCCAATGCTCGCAGTCAAACGGAGCAAAATCTTGCGCAAACGAGCACTCAACTT
GGTCAAACCATTCAAGCGGGCGCGGCACTTAACGACCGTTGGCATGACTGCGTGGGTAAAAACCTAAGCT
ATGGCGAAGGCAGCACCACGGGCTTTAATACCCAAGTCAGCCAAGGTATGAGCAACATGCAAAGCGCGAT
TGACAACGTCAGCAAACAAACGGGATGGAGTAAAGATAAGTCCCAAGCGTACTTGCAAAGCGCTTACGCT
GGCGTGGAAGCTGGCGTAGGAACAGGCAAAGGGAAATCACCATTCAATTTCGGCGCTAACGCTGGGGTGA
AATGGTCAGATGAAGAGCGCACCGCTTACAGCAACATGAGTAGCGAGCAAAAGCAGCAGCTTGAGCAAGC
GACCAAGCAATACACTGAGGGGGCGAATGCTGTCACCACCGCTGGCACGCAAGTGGATAACAAAGACACG
CGAACGTCAGTTGAACAGTTTGCGCATGACTTTGCGATTAACGCCAGCAACACCAAATCTCTGGGTGCCA
GCGTGATGCAAAGCCAATCGGATTTGAACGCTCTCTCCAACACCCAAACGCGTTTGGAATCAGTTGGCGG
CAGCTTTACTGCTAAAGCCGATGGCGCATTCCAGAACTATTTGGAGAAGACCGTTAAACTAGAGCAAGAA
GATGTTGGACGCCTCATGACCGCTTACCAGCCAGAAGACATTGCGGATGCGAAGAAGCATTGGCAAGAAT
TTACTCGCACCGAAGCCTTTGCCACCATGGCTGGACTCGATGGTGACAGCGCGCGCGTCGTGGCCAAGAT
GAACCAAGACCATCAAGCCACCACACCAACAATGCCGCCTTCGCTCACTCCAGAGCAAAGCAAAACCATG
GAGAATGAATGGGAGAAAACACAAGGTGCAGTAGACGCCACCCGCACCGCCGTGATGCACAACAAAGGAA
CCGGTGGGCTGTTTAACCAAGATCGCTTCGACGGGGTCACGGATGACGCGAAGCAGCAGCAAAGCCAGGC
ACAACAGTCAATCGCCAAACCAGAGCCCATCATTGCGCTGACCATCAAGTCACAGGTAGAAGCAGAGGTA
ACAAAACCCGAAAGGACGGAATACGTCACCTCCGACCAATCGTACCCTGCCGCACCAAGATACACCCAAA
ACCCAAACAAGTAG
 Primer design