SecReT4
Protein ID: 153971636
T4SS name [ID]Tra_F [515]
Gene symboltraD
Locus tagpC46021_07
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]40171..42270 [+]
Productputative conjugative transfer protein TraD
Component typeTraD_F
UniProt IDA7DVI6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 5.6e-152, Aligned region: 184..578
TraD_N [PF12615], Evalue: 3.2e-24, Aligned region: 35..130
TraG-D_C [PF12696], Evalue: 1.4e-20, Aligned region: 437..559
T4SS-DNA_transf [PF02534], Evalue: 9.9e-17, Aligned region: 196..560
AAA_10 [PF12846], Evalue: 2.4e-14, Aligned region: 200..511
Protein Sequence: 699 a.a.     [Download]
>gi|153971636|ref|YP_001393154.1| putative conjugative transfer protein TraD [Vibrio vulnificus]
MSRPSRSKGNHFTRGGQITFHSIRMFFQVNNTLVYAAIWAVIALTGFLTWLRAPDNAFWSVFYYWRNQLY
ANLGHDLSSEVTTFWNGKRYVGTLASQLENTQLITLYDNVIRQAQINFLIALAIAFAILMGAMTFFKRQG
EKQSEDLHVRGFQYAEPKRLTQDLKQRAKKLKKQGVGNGKISDFKIDGLALFKHEFEVQHVLIDGTTGSG
KSVMLRKLLRWIRKRGDKAIVYDKGCTFTSKFFDPSQDILLNPFDERCANWDVWCDAKEAPDFENIANAL
IPQHGEGDPFWVDSARTIFSSAAYRMSQDNKPCSTARLLSLILTSEIETLGNFLQGTESAALVSKDIKKT
AISIKSVLATYIKSLRFLDGLDEKDANGELKRKPFSITDWVLDDKQRGFLFLSSNAQQHASLRPLISTWL
AIASNAILGLNPDDDRRIWVIMDEMPSLHKLPELDSIIAEVRKFGGCYVIGLQSYAQLVKTYGKNTADVI
FDLLNSRFYFRAPSAQMAQISSKDLGEQEVDVSRENISYGANTLRDGVSIGHQTITRPVVSSSEIQAMDD
LQCYLRVPGSSFITQLDLHFDKMRDVSAAFIKRDYTLSPAMTKAYEEAIYCECVAPGIFLNDEDRNALTE
IQAKQFETPEEMKLETDQIRQAQRSDTVKELATEDAEKLKSDGDYQERAQQELEEAAISQDSEITNAYE
 
Nucleotide Sequence: 2100 bp     [Download]
>gi|153971581|ref|NC_009702.1|:40171-42270 Vibrio vulnificus pC4602-1 plasmid
ATGTCTAGACCTTCACGCTCCAAAGGCAATCATTTTACCCGTGGTGGACAAATCACCTTTCACTCCATCC
GAATGTTCTTTCAAGTCAACAATACCTTAGTCTACGCTGCTATTTGGGCGGTCATTGCCTTAACCGGATT
TCTCACCTGGTTGCGCGCCCCTGACAATGCCTTTTGGTCTGTGTTCTACTACTGGCGCAACCAACTTTAT
GCCAACCTTGGCCACGATTTAAGCAGCGAAGTGACGACCTTCTGGAATGGAAAGCGTTACGTCGGCACCC
TTGCCTCACAGCTCGAAAACACACAACTCATTACCCTTTACGACAATGTCATACGCCAAGCCCAAATCAA
TTTTTTAATTGCCCTCGCGATTGCTTTCGCTATCTTGATGGGCGCTATGACCTTTTTCAAACGCCAGGGT
GAAAAGCAAAGTGAAGATCTTCACGTACGTGGGTTTCAATACGCAGAGCCGAAAAGACTCACTCAGGATT
TAAAGCAGCGCGCCAAAAAGCTGAAAAAACAAGGCGTAGGCAACGGAAAGATTTCTGATTTTAAAATCGA
CGGGCTCGCCTTATTTAAGCATGAGTTTGAAGTTCAGCACGTATTGATTGATGGAACAACCGGCTCGGGT
AAATCTGTCATGCTGCGTAAGTTGCTGCGGTGGATACGCAAGCGCGGTGACAAAGCCATTGTTTACGACA
AAGGTTGCACTTTCACCAGTAAGTTCTTCGACCCCAGCCAAGATATTTTGCTCAACCCATTTGATGAACG
TTGCGCCAATTGGGACGTGTGGTGCGATGCCAAGGAAGCCCCTGACTTTGAGAACATTGCCAACGCCCTT
ATCCCTCAGCACGGTGAAGGCGATCCGTTCTGGGTGGACTCTGCGCGTACTATCTTCTCTAGTGCAGCCT
ACCGAATGAGTCAAGACAACAAACCTTGCTCGACCGCAAGGTTGCTCAGTCTTATTCTCACCTCTGAGAT
TGAAACGCTAGGCAACTTTTTACAAGGCACAGAATCGGCAGCTCTCGTTTCCAAAGACATTAAAAAAACC
GCGATTTCGATTAAATCCGTTTTGGCCACCTACATAAAAAGCTTACGCTTTCTGGATGGATTAGATGAAA
AAGATGCGAACGGCGAACTCAAACGCAAACCGTTCTCCATCACTGATTGGGTACTCGACGACAAACAACG
TGGCTTTTTGTTCTTATCGAGTAACGCACAACAACACGCCTCCCTACGTCCATTGATTTCTACTTGGCTG
GCCATTGCATCTAACGCCATCTTAGGACTTAACCCAGATGACGACCGCCGAATCTGGGTGATTATGGACG
AGATGCCAAGCCTGCATAAACTGCCAGAACTCGATAGCATCATTGCTGAGGTACGTAAGTTTGGTGGCTG
TTATGTGATTGGTCTCCAGTCGTATGCGCAGCTGGTGAAAACCTACGGCAAGAACACCGCCGATGTGATT
TTTGATTTGCTCAACTCTCGTTTTTACTTCCGCGCACCTTCGGCGCAAATGGCGCAAATCTCCTCCAAAG
ATTTGGGCGAGCAAGAAGTCGATGTATCTAGAGAAAATATCTCTTACGGTGCGAATACGTTGCGTGATGG
GGTATCGATTGGCCACCAAACCATCACCCGCCCTGTCGTATCGAGTAGCGAAATTCAAGCCATGGATGAT
TTGCAATGCTACCTTCGCGTACCAGGCAGCAGTTTTATCACTCAACTGGATTTACACTTTGATAAGATGC
GAGATGTCAGCGCCGCTTTTATAAAACGCGATTACACCCTATCACCGGCGATGACCAAAGCGTATGAAGA
AGCGATTTATTGTGAGTGTGTTGCACCTGGCATTTTCCTCAATGACGAAGATCGCAATGCACTGACCGAA
ATCCAAGCCAAGCAGTTTGAAACGCCCGAAGAGATGAAGCTGGAAACAGATCAAATCAGACAGGCGCAGC
GAAGTGATACAGTCAAGGAGCTGGCCACCGAGGATGCGGAAAAACTCAAATCCGATGGCGACTATCAAGA
GCGAGCTCAGCAAGAATTGGAAGAAGCCGCTATCTCTCAAGATAGCGAAATCACAAACGCCTATGAATAA
 Primer design