SecReT4
Protein ID: 153971637
T4SS name [ID]Tra_F [515]
Gene symboltraI
Locus tagpC46021_12
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]42389..48163 [+]
Productputative conjugative transfer protein TraI
Component typeTraI_F
UniProt IDA7DVI7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 5.7e-81, Aligned region: 7..314
AAA_30 [PF13604], Evalue: 2e-54, Aligned region: 472..570
AAA_30 [PF13604], Evalue: 2e-54, Aligned region: 1015..1208
Toprim_3 [PF13362], Evalue: 1.3e-10, Aligned region: 1758..1849
AAA_19 [PF13245], Evalue: 4e-05, Aligned region: 1023..1097
Protein Sequence: 1924 a.a.     [Download]
>gi|153971637|ref|YP_001393155.1| putative conjugative transfer protein TraI [Vibrio vulnificus]
MLSISPLKSASGAAKYYLSEENPKDLPDVSLEKDAGDNYYLKEKDQGENTFWHGKLAIEAGLVGKAVDQA
TLESVLSGNLGDETIKGKRDDHKSGFDLTFSAPKSISILALTGGDTRLIEAHNNAVKFALTELEKDVAQT
TAINKEGEREFHNTNAMIFAVVRHKTSRENDMQIHSHALAANMTRDQEGQLRTLASSIKQKGGVINGTGE
RIYNFQKYYGILYQSQLAKEAHELGYTTRGVGNGQFEVNGVPQSIIDASSTRKQQIDQRTLDLGFESRAA
RDVATLDTRKGKTHQSNDSLNKQWQSTVREQGYEPSQLVGLAQKVKEQQAAPSLDETKAAISRAIDHLGQ
YNTALHLEKIIELTASEFTKGAVQLNALDIKKATDEMIKTGELIGLSQKGQYTTKGLIDNEKALIDSTQG
RAHHMRTHVEPKMLNKLAIPENQQRLLTELYHSTKQFHVVNVHGSSQGIAQQLLNVGNHSGKRVQFVSQS
AKTKAEGMDNVQRKSQTLGAWIANAFSPEQRHTTHSLLQSDVPLTNKDVLLIDDANKMSANELLALTDKA
KQSNSKVVMLNRVSSRQGFKANNAISLYQKGNVESHTWMSGKPIETDVKLHESDTDRIARVYADLPDKTD
TQVIATSSVEQRRLTEAIRDRLKNTGTLSRHETTLFTQVPHYLSKAQQPLVQHYKPGMTLTHWDKGKPQS
FVIASIDKESNTMTTLSKHDGQSHTFDPSSRAFKAMQMQISKPQSLNIAQGERLSALGKHFPSGLEANQS
YLVTNINKTSITLESQGKTQHLSLESLKDAPLQYDYVRGASHIEKKAHTLLSAKAFTLSKPLINDLTEKT
QRLDIFTDKPDKAQSALEKEQVSPSAIERVLQTQNVNDRYLNDTTQALLKQDVSQALSALAKAQNTPLIE
KAVSFALNHLSEREAAFSQKALVVEAVRYAFEEAGGSITKDQIETELGKRSDTLSAEYSDGTRWTTQAAL
ETEKRILQNIIDGKDRHQPFATPKQVQTFLDTKPRLTQGQKDAITLTSTTPDSFVSIQGLAGTGKSTMLE
SNVELIQLVKEASQLPEQNVIGLAPTHAAVSELESKGVKAQTLESLLSDIRQGNREASDYQHTLFFLDES
SMVSNKQAKEFTELVNASQSKAVLLGDKEQLLSLSAGKPFELAISKGDIDTAYMTDIIRQQNDTLLNAAQ
NTIDKQPQSALDKLKQQAPDSQGNRQHVISTLDENNKDQRKAQLEATEKLPFVVAKDYLERTPETRENTL
IIAYTNKERDTITEYIRVGLMKNRELGKENIITTRLRSIGATGEELSTMMPYQKGLVLSTKPGEYATITH
VDSEHGVVTLEDAKGETKSFLPRNRDHTFTTLFSVSEKPLSTGDKIVTRFTDKSRDIKANVEYRITQASS
DGIIAQTKTGETLTINPSELKDGHWDYAYSRTADMAQGATYPHVITAIQSKGALTNLRRAGIDVTRASQH
IRLYTDNTTQLVKSWLSKESHKASAIETINQIPPKDTTYFNRNALPHEDVRFQNKSGDFDYNKFREHINT
QLPKYTESLATQLLGRPNQSKSDRDYLTFGIGKSAIKVSLTGEHRGYFKDYTTGEKGSLINLMMSHNGMS
YKEAMNEAHKMLNEPEKYKLEENSKHEKLLSTTPRHIAKFEERAKEYISQSQPINNTLAQTYLNNLGINN
IENDNVKFHPSVYSSEDKAYHPAMLTNIHNKQGETKAIEVTYLDSQGNRDNTLDINPRTLGTKSKQLTNF
HQGENLNTTIISTSIENSFLIRDQTQGQIDIINVNHKNDIQNINIDELRQNIIIVLNQGNHDLNPNNIEK
IIENFNGRDIQFMSDDNLKEDIKSCIEKLERDNSVHDIELSDTHSTHQESELDTLNFDEKKETDSQSLEH
FETKEYSPQQEMNFEHQEKESDWEDREIDRELER
 
Nucleotide Sequence: 5775 bp     [Download]
>gi|153971581|ref|NC_009702.1|:42389-48163 Vibrio vulnificus pC4602-1 plasmid
ATGCTTTCTATCAGCCCATTAAAATCTGCCTCTGGCGCGGCCAAATACTACCTAAGCGAAGAAAACCCCA
AAGATCTGCCAGATGTCTCTTTAGAGAAAGATGCCGGTGACAACTACTACCTCAAAGAAAAAGACCAGGG
AGAAAACACCTTTTGGCACGGCAAGCTTGCTATCGAAGCGGGACTGGTTGGCAAGGCCGTAGACCAAGCG
ACATTAGAGTCGGTACTATCGGGCAACCTTGGGGATGAAACCATCAAAGGGAAGCGAGACGATCACAAAT
CAGGGTTTGATCTCACCTTTTCCGCCCCTAAATCCATCAGCATTCTTGCCCTTACCGGTGGAGATACCCG
TCTTATTGAAGCGCATAACAACGCGGTGAAATTCGCCCTCACTGAGCTTGAGAAAGACGTGGCACAAACC
ACCGCCATCAACAAAGAAGGAGAGCGTGAGTTCCACAATACGAACGCCATGATATTTGCGGTCGTGCGCC
ATAAAACCAGCCGTGAAAATGACATGCAAATCCACTCACACGCTCTAGCGGCCAATATGACACGCGATCA
AGAAGGGCAACTTCGCACACTGGCGTCCAGCATCAAACAAAAAGGGGGCGTCATTAACGGCACTGGTGAG
CGCATCTACAACTTCCAAAAATACTACGGTATCTTATATCAAAGCCAACTGGCCAAAGAAGCACACGAAT
TAGGCTATACAACACGAGGTGTCGGCAACGGCCAGTTTGAAGTCAATGGCGTGCCTCAATCCATCATTGA
CGCTTCCTCAACCCGCAAACAACAAATTGACCAGCGCACGCTCGATTTGGGCTTTGAATCTCGCGCCGCT
CGCGATGTGGCAACTCTCGACACTCGCAAAGGCAAAACCCACCAAAGCAATGACAGCCTCAATAAGCAGT
GGCAAAGTACCGTCAGAGAACAAGGGTATGAACCCTCTCAACTCGTTGGTCTCGCGCAGAAAGTAAAGGA
GCAACAAGCAGCCCCTTCACTCGATGAAACGAAAGCCGCCATCAGCAGAGCGATTGACCACTTAGGTCAA
TACAACACTGCTTTGCATCTAGAAAAAATCATCGAACTTACCGCCTCAGAATTCACCAAAGGGGCCGTGC
AGCTAAACGCCCTTGATATCAAAAAAGCCACCGATGAGATGATAAAAACAGGAGAGTTGATAGGACTGAG
CCAAAAAGGGCAATACACCACCAAAGGCTTAATTGACAACGAGAAGGCACTTATCGACAGCACTCAAGGA
CGAGCGCACCATATGCGCACTCACGTTGAACCTAAGATGCTCAATAAACTGGCTATCCCTGAAAACCAGC
AGCGTCTTCTTACCGAATTATACCACTCCACCAAACAGTTCCATGTGGTGAATGTGCATGGCTCATCGCA
AGGTATCGCGCAGCAGCTGCTTAACGTGGGTAATCACAGTGGTAAACGGGTTCAGTTTGTCTCACAAAGC
GCCAAAACCAAAGCCGAAGGGATGGATAACGTACAGCGCAAAAGCCAAACCCTTGGGGCATGGATAGCCA
ATGCTTTTTCCCCAGAGCAGCGACACACCACCCATAGCTTACTGCAAAGCGATGTCCCGCTCACCAATAA
AGACGTCTTACTCATCGATGACGCCAACAAGATGAGCGCCAATGAACTGTTAGCGCTGACCGATAAAGCC
AAGCAATCGAACAGCAAAGTGGTGATGTTAAACCGTGTTTCTAGCCGTCAAGGTTTTAAAGCCAATAACG
CCATCTCGCTGTATCAAAAAGGCAATGTGGAGAGCCATACCTGGATGAGTGGTAAACCCATCGAAACAGA
CGTAAAACTGCATGAAAGTGACACCGACAGGATAGCGCGCGTTTACGCTGACCTCCCCGATAAAACCGAC
ACTCAAGTGATTGCCACTTCCAGTGTCGAGCAACGGCGATTAACCGAAGCCATTCGGGATAGACTCAAAA
ACACCGGTACGCTTTCTCGCCATGAAACCACGCTATTCACTCAAGTCCCCCACTACCTCTCTAAAGCGCA
GCAACCTCTTGTTCAACACTACAAGCCAGGCATGACGCTCACCCATTGGGACAAAGGCAAGCCCCAAAGC
TTTGTCATTGCCAGTATCGATAAAGAGAGCAATACCATGACAACACTCAGCAAACACGACGGGCAGTCAC
ACACGTTTGACCCATCCAGCCGTGCCTTTAAAGCCATGCAGATGCAAATTAGTAAACCGCAAAGCTTGAA
CATCGCCCAAGGAGAGCGCCTTAGCGCGTTAGGTAAACACTTCCCTTCCGGTTTAGAGGCGAACCAAAGT
TACCTTGTCACTAACATCAACAAAACAAGCATTACGCTAGAAAGCCAAGGCAAAACGCAGCACCTCAGCT
TAGAAAGTCTAAAAGACGCACCTTTGCAATATGATTACGTCCGAGGAGCCAGCCATATCGAGAAAAAGGC
GCATACCTTACTCTCCGCGAAAGCGTTTACCCTTTCTAAGCCACTCATCAATGACCTGACCGAAAAAACG
CAGCGTCTTGATATCTTCACCGATAAACCCGATAAAGCCCAAAGCGCACTGGAAAAAGAGCAAGTTTCCC
CGTCAGCGATTGAGCGCGTATTGCAGACACAAAACGTCAACGACCGTTACCTAAACGACACCACCCAAGC
CTTGTTAAAACAAGATGTCAGTCAGGCGTTATCGGCTCTGGCGAAAGCGCAAAACACGCCCCTCATCGAG
AAAGCGGTCAGCTTTGCCCTTAACCACCTTTCAGAGCGAGAGGCGGCGTTTAGCCAAAAAGCGTTAGTGG
TCGAAGCGGTTCGTTACGCCTTTGAAGAAGCCGGCGGCTCGATAACCAAAGACCAAATTGAAACCGAACT
AGGAAAACGCAGTGACACCCTCTCTGCAGAATACAGCGACGGGACACGCTGGACGACACAAGCGGCGCTG
GAGACGGAAAAGCGCATCTTGCAAAACATCATCGACGGAAAAGACCGACATCAGCCTTTTGCTACCCCTA
AGCAGGTGCAAACCTTTCTCGACACCAAACCTCGCTTAACCCAAGGGCAAAAGGACGCCATCACGCTGAC
CTCGACCACCCCAGACAGCTTTGTGTCCATTCAAGGTTTAGCCGGCACGGGTAAATCCACCATGCTGGAA
TCCAACGTTGAGCTTATCCAATTAGTCAAAGAAGCCAGCCAACTGCCTGAGCAAAACGTGATTGGGCTTG
CACCCACTCACGCCGCCGTGTCTGAGCTTGAAAGCAAAGGGGTAAAAGCGCAAACGCTGGAAAGTTTGCT
GTCCGATATCAGGCAAGGCAATCGAGAGGCCAGCGATTATCAACACACCCTATTCTTTCTTGATGAAAGC
TCGATGGTCAGCAACAAACAAGCTAAGGAGTTTACCGAACTGGTCAATGCCAGTCAGTCCAAAGCGGTAC
TTTTAGGTGATAAAGAGCAGTTGTTATCCCTGAGTGCCGGTAAACCGTTTGAACTGGCCATAAGCAAAGG
TGACATCGATACCGCGTACATGACCGACATCATTCGTCAGCAAAACGACACCTTGCTGAATGCGGCGCAA
AACACCATTGATAAGCAACCGCAAAGCGCTCTGGATAAGCTCAAACAGCAAGCCCCTGACAGCCAAGGCA
ACCGCCAGCATGTCATTTCTACGCTGGATGAAAATAACAAAGACCAACGCAAAGCGCAGTTAGAAGCCAC
TGAAAAGCTGCCGTTTGTTGTGGCCAAAGATTATCTAGAGCGCACTCCAGAGACGCGAGAGAATACGCTT
ATCATCGCTTACACCAACAAGGAGCGTGACACCATCACCGAATACATCCGTGTCGGATTAATGAAGAACC
GAGAACTTGGCAAAGAAAACATCATCACCACCAGGCTGCGCTCTATCGGGGCAACAGGGGAAGAACTGTC
TACCATGATGCCCTACCAAAAAGGCTTGGTACTGAGTACCAAGCCAGGGGAATACGCCACCATTACCCAT
GTGGATTCAGAGCATGGCGTGGTAACTCTCGAAGACGCGAAAGGTGAAACCAAATCCTTCTTACCCCGCA
ATCGAGATCATACCTTCACGACATTGTTTAGCGTGTCAGAAAAGCCACTTTCAACAGGCGATAAGATAGT
GACACGCTTTACCGACAAAAGCCGTGACATTAAAGCCAACGTGGAATATCGCATCACGCAAGCAAGCTCA
GACGGCATCATTGCGCAAACGAAAACAGGAGAGACGCTTACCATCAACCCTAGCGAGCTTAAAGATGGGC
ATTGGGATTACGCGTACAGTCGAACCGCCGATATGGCACAAGGGGCCACCTATCCCCATGTCATTACCGC
CATTCAGAGCAAAGGCGCATTGACCAACCTAAGACGCGCCGGTATCGATGTCACCCGTGCCAGTCAACAC
ATCCGACTCTATACCGATAACACCACACAATTGGTCAAAAGCTGGCTATCCAAAGAAAGCCATAAAGCCA
GTGCGATAGAAACCATTAACCAAATTCCACCCAAAGACACCACCTACTTTAACCGCAACGCGCTTCCGCA
TGAGGACGTCCGGTTCCAAAATAAAAGTGGTGACTTTGACTACAATAAATTTAGAGAGCACATCAATACA
CAGCTACCAAAATACACCGAAAGTCTTGCCACTCAGTTATTAGGCAGACCGAATCAATCCAAGTCAGACC
GCGATTACTTAACCTTTGGCATTGGCAAATCCGCCATTAAAGTTTCTTTAACAGGTGAGCACCGTGGTTA
TTTTAAAGACTACACAACGGGCGAAAAAGGCTCACTTATCAACCTAATGATGAGCCATAACGGCATGAGT
TATAAAGAGGCAATGAATGAAGCCCATAAAATGCTCAATGAGCCAGAAAAATACAAGCTGGAGGAAAACA
GCAAACACGAAAAATTACTGAGCACCACACCAAGGCATATAGCCAAGTTTGAAGAAAGAGCCAAAGAGTA
CATAAGTCAAAGCCAGCCAATCAATAATACTTTGGCGCAGACGTACTTAAACAACCTTGGTATCAATAAC
ATTGAAAACGACAATGTAAAATTTCACCCTTCGGTGTACTCATCCGAAGATAAAGCTTATCACCCTGCCA
TGTTAACTAACATCCACAACAAACAAGGTGAAACAAAAGCCATTGAAGTCACCTATTTAGATTCGCAAGG
AAATAGAGACAACACGCTAGACATTAATCCAAGAACACTAGGCACCAAATCCAAACAGTTAACAAATTTC
CACCAAGGAGAGAATTTAAACACGACCATCATCAGCACCTCGATTGAAAATTCATTTTTAATTCGAGATC
AAACCCAAGGACAGATTGACATTATTAATGTCAATCACAAGAACGACATTCAAAACATCAATATCGATGA
ACTGAGACAGAACATCATTATTGTACTAAACCAAGGCAATCACGACTTAAACCCAAATAACATTGAGAAA
ATCATCGAGAACTTCAATGGACGAGACATTCAATTCATGTCAGATGATAATCTCAAGGAAGACATTAAGT
CGTGCATTGAAAAACTAGAGAGGGACAACAGCGTACACGATATTGAATTAAGTGACACACACTCCACTCA
TCAAGAAAGCGAATTAGACACATTGAACTTTGATGAGAAAAAAGAAACCGATAGCCAATCACTTGAACAC
TTTGAGACAAAAGAATATTCACCTCAGCAAGAGATGAACTTTGAACATCAAGAGAAAGAAAGTGATTGGG
AGGACAGAGAAATTGACAGAGAATTAGAACGATAA
 Primer design