SecReT4
Protein ID: 153971639
T4SS name [ID]Tra_F [515]
Gene symbolpilT
Locus tagpC46021_04
StrainVibrio vulnificus plasmid pC4602-1 (NC_009702)
Repliconplasmid pC4602-1 [GenBank: NC_009702] [Browse all T4SS(s) in this replicon]
Location [Strand]49107..49553 [-]
Productputative PilT protein
Component typeOrf169_F
UniProt IDA7DVA1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 148 a.a.     [Download]
>gi|153971639|ref|YP_001393157.1| putative PilT protein [Vibrio vulnificus]
MKKISMLPFLLVSQSVSAFCFDEAGAYYNVDPELLEAIAKVESSLNPSAYNENKNSAGKVVSRDFGLMQI
NSSWFEKLSDFNVNEHNVYEPCFNVSLGAWVLSSNFASHGYNWNSVGAYNAGFSKRTENARKIYIQKVKS
VYYPQKVK
 
Nucleotide Sequence: 447 bp     [Download]
>gi|153971581|ref|NC_009702.1|:c49553-49107 Vibrio vulnificus pC4602-1 plasmid
ATGAAAAAGATTTCAATGTTGCCTTTTCTTCTCGTTTCTCAATCTGTCAGTGCATTTTGTTTTGATGAGG
CGGGGGCGTATTACAATGTTGATCCTGAATTATTAGAAGCGATCGCAAAAGTTGAAAGTAGCCTTAACCC
CTCTGCTTATAACGAAAATAAAAACTCTGCTGGTAAGGTCGTAAGTAGAGATTTTGGTTTAATGCAAATT
AACTCAAGTTGGTTTGAAAAACTTTCAGATTTTAATGTGAATGAGCATAATGTTTATGAACCTTGTTTTA
ATGTGTCTTTAGGAGCGTGGGTGCTTAGTTCTAACTTTGCTAGTCACGGTTATAACTGGAATAGTGTCGG
TGCGTATAATGCGGGTTTCTCCAAGCGCACTGAGAACGCCAGAAAAATATACATCCAAAAAGTTAAATCT
GTTTATTATCCCCAAAAAGTTAAATAA
 Primer design