SecReT4
Protein ID: 154148018
T4SS name [ID]VirB [429]
Gene symbolvirB
Locus tagCHAB381_0172
StrainCampylobacter hominis ATCC BAA-381
Repliconchromosome [GenBank: NC_009714] [Browse all T4SS(s) in this replicon]
Location [Strand]153486..154472 [-]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDA7HZT9
KEGG IDcha:CHAB381_0172
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.5e-60, Aligned region: 19..295
Protein Sequence: 328 a.a.     [Download]
>gi|154148018|ref|YP_001405780.1| P-type DNA transfer ATPase VirB11 [Campylobacter hominis ATCC BAA-381]
MSGIRSSVSLSKYSNEYFGKYLQDDTINEICYNGGTAIFYEDSKGNWHIDENANFDYEKAIAFATSCASF
KKDQIDKTKPILSCVLPTGERVQIVIPPATKDGIVSITIRKPSKVRYTLNDYISSGSIDKNSADFFIQAI
KQGKNIVICGETGSGKTTLMKTFIDFIPLDERIITIEDVEEIRFYEHKNYQQLFYPSEAKESDFLNSTAL
LKSCLRMKPSRILLAEVRGAETYDFLNVISSGHNGSMTSCHAGSVKNCYNRLAMMSMQNEIARSLGKDMI
LDIIKNIIDLVIVFKKEHNGIRRVAEYLYEQKLYKNFDGIFKEVKDFV
 
Nucleotide Sequence: 987 bp     [Download]
>gi|154147866|ref|NC_009714.1|:c154472-153486 Campylobacter hominis ATCC BAA-381, complete genome
ATGAGCGGTATTAGAAGCAGTGTTTCATTAAGTAAATATTCAAATGAATATTTTGGAAAATATTTACAAG
ATGACACAATTAACGAAATTTGCTATAACGGTGGCACTGCTATTTTTTATGAAGATAGCAAAGGCAATTG
GCATATTGATGAAAATGCAAATTTTGATTATGAAAAAGCAATAGCATTTGCTACTTCTTGTGCCTCTTTC
AAAAAAGATCAAATAGACAAAACAAAACCAATACTTTCTTGTGTATTGCCAACTGGTGAGAGGGTTCAAA
TCGTAATACCACCAGCGACAAAAGATGGTATTGTTTCAATCACAATTAGAAAACCATCAAAAGTTCGATA
TACATTAAATGATTATATATCAAGTGGATCAATTGATAAAAATAGTGCTGATTTCTTTATTCAAGCCATT
AAACAAGGAAAAAATATTGTCATTTGTGGCGAAACTGGAAGTGGAAAAACTACTTTAATGAAAACTTTTA
TTGATTTTATTCCGCTAGATGAAAGAATTATAACCATTGAAGATGTTGAAGAAATAAGATTTTACGAACA
TAAAAACTATCAACAACTCTTTTATCCAAGCGAAGCAAAAGAAAGTGATTTTCTAAACTCAACAGCTCTT
TTGAAATCTTGCCTTAGAATGAAACCAAGCAGAATCTTGCTCGCAGAAGTTAGGGGAGCTGAAACATATG
ATTTTTTAAATGTTATCTCAAGCGGACACAATGGCTCAATGACAAGTTGTCACGCAGGAAGTGTCAAAAA
TTGCTACAACAGACTAGCAATGATGTCTATGCAAAATGAAATTGCCAGATCTCTTGGTAAAGATATGATA
CTTGACATTATAAAAAATATCATCGATTTAGTAATAGTCTTTAAAAAAGAGCATAACGGAATTAGGCGAG
TAGCTGAATATTTATACGAACAAAAACTATATAAAAACTTTGATGGAATTTTTAAAGAAGTTAAGGATTT
TGTATGA
 Primer design