SecReT4
Protein ID: 154148596
T4SS name [ID]VirB [429]
Gene symbol-
Locus tagCHAB381_0179
StrainCampylobacter hominis ATCC BAA-381
Repliconchromosome [GenBank: NC_009714] [Browse all T4SS(s) in this replicon]
Location [Strand]158705..159472 [-]
Producttransport associated protein 4
Component typeVirB5
UniProt IDA7HZU6
KEGG IDcha:CHAB381_0179
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.2e-29, Aligned region: 27..233
Protein Sequence: 255 a.a.     [Download]
>gi|154148596|ref|YP_001405787.1| transport associated protein 4 [Campylobacter hominis ATCC BAA-381]
MKISFKKTSFTVLICLFLNINLLNASGIPVVDAAANAQMTTQNLKQIAEWAKEAKRWVDTTTHYSAQLNA
YAKQLATQSGVRDVTSFLEEAKDVYDEAKKVGTTLGELKDFKNSGKDSISSKVKKLMDKFFEYDYCKDIV
DVDKTTQNICYQKRSANIEDIVFYKERSDTIGMYSKNINKLAKKLQKSKDIKESSDLNNAIQAQVALMQA
EKIQIDLYAKQRENSKNIMEDRELENRTNRLMNNYIDWGSFDPYN
 
Nucleotide Sequence: 768 bp     [Download]
>gi|154147866|ref|NC_009714.1|:c159472-158705 Campylobacter hominis ATCC BAA-381, complete genome
ATGAAAATAAGTTTTAAAAAAACTTCTTTTACGGTTTTAATATGTTTATTTTTAAACATAAATTTGTTAA
ATGCAAGTGGTATTCCAGTAGTTGATGCTGCTGCAAATGCTCAAATGACTACTCAAAATTTAAAACAAAT
TGCAGAGTGGGCAAAAGAAGCTAAAAGGTGGGTAGATACTACAACTCACTATTCTGCACAATTAAATGCA
TATGCAAAACAACTTGCAACTCAAAGCGGTGTGAGAGATGTTACTTCTTTTTTAGAAGAAGCAAAAGATG
TGTATGATGAAGCAAAGAAAGTTGGAACAACTCTTGGAGAGTTAAAAGATTTTAAAAATAGCGGAAAAGA
TAGTATAAGCTCAAAAGTTAAAAAATTGATGGATAAGTTTTTTGAATATGACTATTGTAAAGATATTGTT
GATGTAGATAAAACTACGCAAAATATCTGCTATCAAAAAAGAAGTGCAAACATAGAAGATATTGTTTTTT
ATAAAGAAAGAAGTGACACAATAGGTATGTATTCGAAAAATATAAATAAATTAGCTAAAAAACTACAAAA
AAGTAAAGATATTAAAGAAAGCTCTGATTTAAACAATGCAATACAAGCTCAAGTTGCACTTATGCAAGCA
GAAAAAATTCAAATAGATTTATATGCTAAACAAAGGGAAAATTCAAAAAATATTATGGAAGATAGAGAGT
TAGAAAATAGAACTAATCGTCTTATGAATAACTATATTGATTGGGGTTCGTTTGACCCTTATAACTAA
 Primer design