SecReT4
Protein ID: 154149168
T4SS name [ID]VirB [429]
Gene symbol-
Locus tagCHAB381_0170
StrainCampylobacter hominis ATCC BAA-381
Repliconchromosome [GenBank: NC_009714] [Browse all T4SS(s) in this replicon]
Location [Strand]150762..152738 [-]
Productcmgd4
Component typeVirD4
UniProt IDA7HZT7
KEGG IDcha:CHAB381_0170
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.2e-103, Aligned region: 116..573
TraG-D_C [PF12696], Evalue: 4e-21, Aligned region: 418..536
TrwB_AAD_bind [PF10412], Evalue: 3.5e-12, Aligned region: 357..550
Protein Sequence: 658 a.a.     [Download]
>gi|154149168|ref|YP_001405778.1| cmgd4 [Campylobacter hominis ATCC BAA-381]
MQDKLNKAQIIFLSIVAIVISYFLTSVVIFVLNDALKLLPKVWKPEFTFLALINGYPKVYEALTISLFLS
FSVVFLLPFIPKKEKLYGNARFANSADIRKMGLFPKKGKDGKIDNNGIIIGMYNNQLLRFGGQQFVALGA
PTRSGKGVGIVIPNLLDYPNSCVVQDIKLECFEYTSKYRKEILKQDIFLFNPYSFKTHRYNPLFYIDMKG
ENADAELNDFANILYPLKNDGSVTDYFNGKAKDLFIGLCYMMNDLLGTRKGIAFLQKYELECSFSLYGIL
KLSEGLNFEVEIADGEIKTISNFADTYNTLVEMKMVSPKAKERIDAFFEIKSDNERSSAMGSFISPLAIF
RADNMRLATSANDFDFRDLRRKKMTIYIGITPDKLASAKPILNIFWQQLILINVQQGLPQSNKELKHPCL
LLMDEFTASGYLATYSSAISFMAGYDLRSLIIYQADSQLTNNKPEGYGQAEANTLLKNHACRIYYAMKDD
DAKRLSESLGTKTVKQRSRNLGQGGGGSESETSRALMLSKEIEEMPFDTEIIKIEGKPPIKCKKALYYSN
KYFMDKFKEVSPSLKNIKEIPNRKSLENAIQNGETYIKIPLQNEETLQNYLKENIEKRLNELPIEEDAEI
ENALDNINIEDEEYNSDEYENFETRGNL
 
Nucleotide Sequence: 1977 bp     [Download]
>gi|154147866|ref|NC_009714.1|:c152738-150762 Campylobacter hominis ATCC BAA-381, complete genome
ATGCAAGATAAGTTAAATAAAGCTCAAATCATATTTTTATCTATTGTTGCTATTGTTATATCTTATTTTT
TAACAAGTGTTGTAATATTTGTATTAAATGACGCCTTAAAACTACTTCCAAAAGTATGGAAGCCTGAATT
TACATTTTTAGCCTTAATTAATGGTTATCCAAAAGTATATGAAGCACTGACCATTTCTCTATTTTTAAGT
TTTAGTGTAGTTTTCTTACTCCCCTTTATACCAAAAAAAGAAAAATTATATGGAAATGCAAGATTTGCAA
ACTCAGCAGATATAAGAAAAATGGGGTTATTTCCTAAAAAAGGAAAAGATGGAAAAATAGATAACAACGG
AATTATTATAGGTATGTATAATAACCAGCTTTTGAGATTTGGTGGGCAACAATTTGTAGCACTTGGAGCT
CCAACAAGAAGCGGAAAAGGTGTTGGTATAGTTATACCAAATTTGCTTGATTATCCAAATTCTTGCGTTG
TTCAAGATATAAAATTAGAATGTTTTGAATATACCAGTAAATATAGAAAAGAAATTCTAAAACAAGATAT
ATTTTTATTCAACCCATATAGTTTTAAAACTCATCGTTATAATCCACTTTTTTATATAGATATGAAAGGT
GAAAATGCCGATGCTGAACTAAACGACTTTGCAAATATTTTATATCCACTTAAAAATGATGGCTCAGTAA
CTGATTATTTTAATGGAAAAGCAAAAGATCTTTTTATTGGGCTTTGCTATATGATGAATGACCTGCTTGG
GACTAGAAAAGGTATAGCATTTTTACAAAAATATGAACTTGAATGCTCATTTTCTTTATATGGAATCTTA
AAATTGAGTGAAGGATTAAATTTTGAAGTAGAAATAGCCGATGGAGAGATAAAAACAATATCAAATTTTG
CAGATACTTACAATACTTTAGTAGAAATGAAAATGGTATCTCCAAAGGCAAAAGAAAGAATTGATGCATT
CTTTGAAATTAAAAGCGATAATGAAAGAAGTTCAGCAATGGGTAGTTTTATATCCCCATTAGCAATATTT
AGAGCTGATAATATGAGACTAGCTACTTCTGCAAATGACTTTGATTTTAGGGACTTAAGGCGTAAAAAAA
TGACAATTTATATTGGAATTACGCCTGATAAATTGGCTTCTGCAAAGCCTATTTTGAATATATTTTGGCA
ACAGCTCATTTTAATAAATGTTCAGCAAGGCTTACCACAATCAAATAAAGAGCTAAAACATCCTTGCCTT
CTTTTAATGGATGAATTTACAGCAAGTGGATATTTGGCAACTTATTCATCAGCTATATCATTTATGGCTG
GATACGACTTAAGAAGTCTAATAATATATCAAGCAGATTCTCAACTTACCAACAACAAACCAGAAGGATA
TGGACAAGCAGAAGCTAATACACTTCTTAAAAACCACGCTTGTAGGATTTATTATGCTATGAAAGATGAT
GATGCAAAAAGATTAAGTGAATCTCTTGGCACAAAAACAGTTAAGCAAAGAAGCAGAAATTTAGGTCAAG
GCGGTGGAGGTAGTGAAAGTGAAACAAGTAGAGCTTTAATGCTTTCAAAAGAGATCGAGGAGATGCCGTT
TGATACAGAAATTATCAAAATAGAGGGCAAACCACCGATTAAATGCAAAAAGGCTCTATATTATTCAAAC
AAATATTTTATGGATAAATTCAAAGAAGTAAGTCCTAGTTTAAAAAATATAAAAGAAATTCCAAATAGAA
AATCATTAGAAAATGCAATTCAAAATGGTGAAACTTATATAAAAATACCACTTCAAAATGAAGAAACACT
ACAAAATTATTTAAAAGAAAATATAGAAAAAAGACTTAATGAATTGCCAATAGAAGAAGATGCTGAGATA
GAAAATGCATTAGACAATATAAATATAGAAGATGAGGAGTATAACAGTGATGAGTATGAAAATTTTGAAA
CAAGGGGAAATTTATGA
 Primer design