SecReT4
Protein ID: 154149274
T4SS name [ID]VirB [429]
Gene symbol-
Locus tagCHAB381_0176
StrainCampylobacter hominis ATCC BAA-381
Repliconchromosome [GenBank: NC_009714] [Browse all T4SS(s) in this replicon]
Location [Strand]156790..157467 [-]
ProductcmgB8
Component typeVirB8
UniProt IDA7HZU3
KEGG IDcha:CHAB381_0176
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.8e-59, Aligned region: 10..222
Protein Sequence: 225 a.a.     [Download]
>gi|154149274|ref|YP_001405784.1| cmgB8 [Campylobacter hominis ATCC BAA-381]
MIDNNDTKTAISYEASIRYLVEKSNRRAWLIAFLSIFISIISVTAVVFLTPLKSVEPYVIRVDNTTGMVD
IITSVNQTEFVSDNEALDKYFTTSYVKIREGYFYNILQNDYTTVQIWSSPEVSSDYLKIYEGDNSRVDIL
KNRTEIDVEINSVTLGNSNGMKMATIRFNQIYKDAKSRTITNKKAKIVTLAYDYSPQSLMTENERLINPL
GFKVLTYRVDDEVER
 
Nucleotide Sequence: 678 bp     [Download]
>gi|154147866|ref|NC_009714.1|:c157467-156790 Campylobacter hominis ATCC BAA-381, complete genome
ATGATAGACAATAATGACACAAAAACTGCTATAAGTTATGAAGCTAGTATCAGATACTTGGTTGAAAAAT
CAAATCGTAGAGCTTGGCTAATAGCTTTTTTATCAATTTTTATATCAATTATAAGTGTTACAGCAGTTGT
ATTCTTAACGCCGTTAAAAAGTGTAGAGCCTTATGTTATAAGAGTTGACAATACAACTGGAATGGTAGAT
ATTATAACTTCTGTAAATCAGACAGAATTTGTATCTGACAATGAAGCATTAGATAAATATTTCACTACTT
CTTATGTAAAAATTCGTGAAGGGTATTTTTATAATATTTTACAAAACGATTATACCACTGTTCAAATTTG
GTCTAGTCCTGAAGTAAGTTCTGATTATTTAAAAATATATGAAGGTGATAATTCTAGAGTTGATATTTTA
AAAAATAGAACTGAAATAGATGTAGAAATTAATTCTGTTACTCTTGGAAATAGCAATGGAATGAAGATGG
CTACTATAAGATTTAATCAAATTTATAAAGATGCGAAATCTCGCACAATTACAAATAAAAAAGCTAAAAT
TGTAACTCTTGCATACGATTATTCTCCACAATCGTTAATGACAGAAAATGAAAGATTAATTAATCCACTA
GGTTTTAAAGTTTTAACATATAGAGTTGATGATGAAGTGGAAAGGTAG
 Primer design