SecReT4
Protein ID: 154243862
T4SS name [ID]VirB [193]
Gene symbol-
Locus tagXaut_5000
StrainXanthobacter autotrophicus Py2
Repliconplasmid pXAUT01 [GenBank: NC_009717] [Browse all T4SS(s) in this replicon]
Location [Strand]218087..219994 [-]
Productconjugal transfer coupling protein TraG
Component typeVirD4
UniProt IDA7IQA3
KEGG IDxau:Xaut_5000
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.5e-96, Aligned region: 162..633
TraG-D_C [PF12696], Evalue: 2.6e-30, Aligned region: 471..594
TrwB_AAD_bind [PF10412], Evalue: 2.3e-21, Aligned region: 385..610
Protein Sequence: 635 a.a.     [Download]
>gi|154243862|ref|YP_001409435.1| conjugal transfer coupling protein TraG [Xanthobacter autotrophicus Py2]
MKGRLNPTLLHVLVPIAVTAMTVFVSGWRWQNLAVGMSSKIAYWFLRGAPLPALLLGPLAGLLTVWALPL
HQRRPIAMVTLLCFLGVAGFYALREYGRLGPFVESGTIPWDRALSYLDAFAVVGAIVGFLIVAVAARISV
VVPDPVKRAKRAAFGDADWLSLSAAGRLFPADGEIVIGERYRVDREIIHELPFDPMDRSTWGQGGHAPLL
TYKQDFDSTHMLFFAGSGGFKTTSNVVPTALRYSGPLICLDPSTEVAPMVREHRMRALGREVMVLDPTNP
VAGFNVLDGIEGSRQKEEDIVGIAHMLLSESLRFESSTGAYFQNQAHNFLTGLLAHVMLSPEYAGRRNLR
SLRQIVSEPEPSVLAMLRDIHEHSESTFIRETLGVFTNMTEQTFSGVFSTASKDTQWLSLDNYAALVCGN
AFRSRDIVSGKKDVFLNIPASILRSYPGIGRVIIGSLINAMVQADGAFARRALFMLDEVDLLGYMRVLEE
ARDRGRKYGITLMMMYQSVGQLEQHFGKAGATSWIDGCAFASYAAIKALETARNVSAQCGEMTVEVQGQS
RNVGWSSSSNGDRRSESVSFQRRPLIMPHEITQSMRRDEQIIIVQGHSPIRCGRAIYFRRKDMNAEAKAN
RFVKV
 
Nucleotide Sequence: 1908 bp     [Download]
>gi|154243668|ref|NC_009717.1|:c219994-218087 Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence
ATGAAGGGGCGTCTGAACCCGACGCTGCTCCATGTTCTCGTGCCGATCGCCGTCACGGCCATGACGGTCT
TCGTCAGCGGCTGGCGATGGCAGAATCTCGCCGTGGGCATGTCCAGCAAGATCGCCTATTGGTTTCTGCG
CGGGGCGCCGCTGCCTGCCCTTCTGCTGGGTCCCCTCGCCGGGCTCCTGACCGTCTGGGCGCTGCCGCTG
CACCAGCGCCGGCCGATCGCCATGGTGACGCTCCTGTGCTTTCTCGGCGTGGCCGGCTTCTACGCCTTGC
GCGAATATGGCCGCCTCGGACCGTTCGTCGAGAGCGGAACCATCCCATGGGACCGGGCGCTGTCGTACCT
CGATGCTTTCGCCGTCGTCGGTGCCATCGTTGGATTTCTGATCGTGGCCGTGGCGGCCCGCATCTCCGTT
GTCGTTCCCGATCCGGTCAAGCGCGCGAAGCGGGCGGCTTTCGGCGATGCGGACTGGTTGTCCCTGTCGG
CGGCCGGGAGGCTGTTCCCGGCGGACGGGGAGATCGTGATCGGCGAGCGCTATCGCGTCGATCGGGAGAT
CATCCACGAGCTGCCGTTCGATCCCATGGACCGGTCCACCTGGGGCCAGGGCGGACATGCTCCGCTTCTG
ACCTACAAGCAGGATTTCGATTCCACCCATATGCTGTTTTTCGCCGGCTCCGGCGGCTTCAAGACGACGA
GCAATGTTGTCCCCACGGCCCTGCGCTATTCCGGTCCGCTGATCTGCCTCGATCCCTCGACCGAGGTCGC
GCCGATGGTGCGCGAGCATCGCATGCGCGCGCTCGGCCGGGAGGTCATGGTGCTCGATCCCACCAATCCG
GTCGCCGGCTTCAACGTGCTCGACGGCATCGAGGGATCGCGGCAGAAGGAAGAGGACATCGTCGGCATCG
CGCACATGCTGCTCTCCGAGAGCCTGCGCTTCGAATCCTCGACCGGCGCCTATTTCCAGAACCAGGCGCA
CAACTTTCTGACCGGGCTTCTGGCGCACGTGATGCTCTCGCCCGAATATGCCGGCCGGCGCAATCTGCGC
AGCCTGCGCCAGATCGTGTCCGAGCCGGAGCCATCCGTGCTCGCCATGCTCCGCGATATTCACGAGCACT
CCGAGTCCACGTTCATCCGCGAGACGCTCGGCGTGTTCACGAACATGACCGAGCAGACGTTCAGCGGCGT
CTTTTCCACCGCCTCGAAGGACACGCAGTGGCTCTCGCTCGACAATTACGCCGCCCTCGTCTGCGGCAAT
GCCTTCAGGTCGCGCGACATCGTCTCCGGCAAGAAGGACGTCTTCCTCAATATCCCGGCGTCGATCCTGA
GGTCCTATCCCGGCATCGGCCGGGTCATTATCGGCTCGCTCATCAACGCCATGGTGCAGGCCGATGGCGC
CTTCGCGCGCCGCGCCCTCTTCATGCTCGATGAGGTGGACCTGCTCGGCTACATGCGGGTCCTGGAAGAG
GCCCGCGATCGCGGCCGCAAGTACGGCATCACGCTGATGATGATGTACCAATCGGTCGGTCAGCTGGAGC
AGCATTTCGGCAAGGCCGGAGCGACATCGTGGATCGATGGCTGCGCCTTCGCCTCCTACGCCGCGATCAA
GGCGCTGGAGACCGCGCGTAACGTCTCGGCGCAGTGCGGCGAGATGACGGTCGAGGTTCAGGGCCAGTCG
CGCAATGTGGGCTGGAGCAGCTCGAGCAATGGCGACCGGCGCTCGGAAAGCGTCAGCTTCCAGCGCCGGC
CGCTCATCATGCCGCATGAGATCACCCAGTCGATGCGCAGGGACGAGCAGATCATCATCGTGCAGGGGCA
CAGTCCGATCCGCTGCGGGCGGGCGATCTATTTCCGGCGCAAGGACATGAATGCGGAGGCCAAGGCCAAC
CGCTTCGTCAAGGTGTGA
 Primer design