SecReT4
Protein ID: 154243939
T4SS name [ID]VirB [193]
Gene symbol-
Locus tagXaut_5078
StrainXanthobacter autotrophicus Py2
Repliconplasmid pXAUT01 [GenBank: NC_009717] [Browse all T4SS(s) in this replicon]
Location [Strand]301042..302055 [-]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDA7IQI0
KEGG IDxau:Xaut_5078
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.3e-80, Aligned region: 16..316
Protein Sequence: 337 a.a.     [Download]
>gi|154243939|ref|YP_001409512.1| P-type DNA transfer ATPase VirB11 [Xanthobacter autotrophicus Py2]
MTEGADVGVVRDLLFPLAQFLSDETLYEIVINRPGVVLTEGPGGWRRHEAPDLTFEKLMRLARAVASYSH
QAIDEAHPLLSATLPDEHRIQIVIPPATPKGTVSITLRNPSAVALTLDDLETAGLFSEVSPIPDELSAAD
ARLLELYQAGSYMPFLREAVLARKNIIISGATRSGKTTLSKALIQHIPEDERLITIEDTPELVIPQDNHV
RLFYSKDGQGLAKIGAKELLEASLRMRPDRVLLQELRDGTAFYYIRNVNSGHPGSITTVHADSARLAFEQ
LTLLVKESDGGHDLERSDIRDLLKIAIDVIVQCKRVSGRFRVTEIYFDPHQDSDANG
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|154243668|ref|NC_009717.1|:c302055-301042 Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence
ATGACAGAAGGAGCAGATGTCGGCGTCGTCCGCGACCTGCTTTTCCCCCTCGCGCAGTTCCTCAGCGACG
AGACGCTCTACGAGATCGTGATCAACCGCCCGGGCGTGGTCCTGACCGAGGGTCCCGGCGGGTGGCGCAG
GCACGAAGCACCGGATCTCACGTTCGAGAAGCTGATGCGGCTCGCGCGGGCCGTGGCGAGCTATTCGCAC
CAGGCGATCGACGAAGCTCACCCACTGCTCTCAGCCACCCTGCCCGATGAGCATCGCATCCAGATCGTCA
TTCCACCCGCCACCCCTAAAGGCACGGTGAGTATCACGCTCCGCAATCCCTCCGCGGTCGCGCTGACGCT
CGACGATCTCGAAACCGCCGGCCTCTTCTCGGAAGTCAGTCCGATCCCTGACGAGCTCTCGGCAGCCGAC
GCCAGGCTGCTCGAGCTATACCAAGCCGGAAGCTACATGCCGTTCTTGCGGGAGGCGGTGCTCGCTCGAA
AGAACATCATCATTTCGGGCGCGACGCGGTCCGGCAAGACCACGCTCTCGAAGGCGCTGATCCAACATAT
CCCCGAAGACGAACGGCTGATCACCATCGAGGACACGCCCGAACTCGTGATCCCGCAGGATAACCATGTG
CGGCTGTTCTATTCGAAGGACGGGCAGGGGCTGGCCAAGATCGGGGCGAAGGAGCTTTTGGAGGCATCCT
TGCGTATGCGTCCGGATCGCGTCCTGCTGCAGGAGCTCCGCGACGGCACCGCCTTCTATTACATCCGCAA
CGTGAATTCAGGACATCCCGGCTCGATCACCACCGTACATGCCGATTCCGCCAGGTTGGCGTTCGAGCAG
CTTACGCTGCTCGTGAAGGAATCTGATGGTGGGCACGACCTCGAGCGGAGCGATATCCGCGACCTGCTGA
AGATCGCGATCGACGTCATCGTTCAGTGCAAACGCGTAAGCGGGAGATTTCGGGTGACGGAGATCTATTT
CGACCCACACCAAGATAGCGACGCGAACGGGTAG
 Primer design