SecReT4
Protein ID: 154243942
T4SS name [ID]VirB [193]
Gene symbol-
Locus tagXaut_5081
StrainXanthobacter autotrophicus Py2
Repliconplasmid pXAUT01 [GenBank: NC_009717] [Browse all T4SS(s) in this replicon]
Location [Strand]304098..304769 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDA7IQI3
KEGG IDxau:Xaut_5081
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.9e-66, Aligned region: 13..220
Protein Sequence: 223 a.a.     [Download]
>gi|154243942|ref|YP_001409515.1| VirB8 family protein [Xanthobacter autotrophicus Py2]
MVTNESLKSYFEKARRFDQDRMIRAERSTRVAWFVAICASILAAAAVFAVAGLTPLKTVQPFVVRVDNST
GIVDVVSALTATAGTYDEAVTKYFAARYVRAREAYVWSEAEENFRTVALLSTQAEQQRFAALYRGSNPES
PQNIYVRSATARINIVSISLINPHVVSVRYIRTVTRGEDVRTTHWVATLTFAYVNAPMSATDRLVNPLGF
VVSEYRADPEAIN
 
Nucleotide Sequence: 672 bp     [Download]
>gi|154243668|ref|NC_009717.1|:c304769-304098 Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence
ATGGTGACGAACGAAAGCCTTAAAAGTTATTTCGAGAAAGCCCGCCGGTTCGATCAGGACCGGATGATCC
GGGCGGAGCGCTCGACCCGGGTCGCCTGGTTCGTGGCGATCTGCGCCAGCATCCTGGCGGCGGCCGCGGT
CTTCGCGGTTGCGGGTCTGACGCCGCTAAAGACGGTGCAGCCCTTTGTCGTCAGGGTCGACAATTCCACA
GGCATCGTCGATGTGGTCTCGGCCCTGACCGCGACCGCCGGAACCTACGACGAGGCCGTCACCAAGTATT
TCGCGGCGCGATACGTCCGGGCGCGGGAGGCCTATGTCTGGAGCGAGGCGGAAGAGAACTTCCGGACCGT
CGCCCTTCTTTCCACCCAGGCCGAGCAGCAACGGTTCGCCGCGCTCTATCGCGGCAGCAATCCGGAATCT
CCCCAGAACATCTATGTCCGCAGCGCCACTGCCCGGATCAACATCGTCTCGATCTCGCTGATCAACCCTC
ACGTGGTGTCGGTCCGCTACATCCGCACCGTCACGCGCGGAGAGGATGTCCGCACCACCCATTGGGTGGC
AACGTTGACCTTCGCCTATGTCAACGCGCCCATGTCCGCGACGGACCGGTTGGTCAATCCGCTCGGCTTT
GTCGTGAGCGAGTACCGGGCCGACCCGGAGGCCATCAATTGA
 Primer design