SecReT4
Protein ID: 154243943
T4SS name [ID]VirB [193]
Gene symbol-
Locus tagXaut_5082
StrainXanthobacter autotrophicus Py2
Repliconplasmid pXAUT01 [GenBank: NC_009717] [Browse all T4SS(s) in this replicon]
Location [Strand]304769..305050 [-]
Producttype IV secretion system protein VirB7
Component typeVirB7
UniProt IDA7IQI4
KEGG IDxau:Xaut_5082
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 93 a.a.     [Download]
>gi|154243943|ref|YP_001409516.1| type IV secretion system protein VirB7 [Xanthobacter autotrophicus Py2]
MLRSFLLLCMASALSGCASWSYPLPKCDGYARRPLNRAMWQWEGSSNVKAQSDAAPLAPNRATAFADEAP
ASPTGPFAHLDSAGSYRSCAGQG
 
Nucleotide Sequence: 282 bp     [Download]
>gi|154243668|ref|NC_009717.1|:c305050-304769 Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence
ATGTTGCGTTCGTTCCTATTGCTCTGCATGGCGTCGGCTCTCAGCGGCTGTGCCTCTTGGTCTTATCCCT
TGCCCAAATGCGACGGCTACGCGCGCCGGCCGCTTAACCGCGCCATGTGGCAGTGGGAGGGGAGCAGTAA
CGTGAAGGCGCAGTCGGACGCTGCGCCCCTGGCGCCGAACCGCGCAACGGCATTTGCCGATGAGGCGCCG
GCATCGCCAACTGGCCCGTTCGCGCATCTCGACAGCGCCGGTTCCTACCGATCTTGCGCGGGGCAGGGGT
GA
 Primer design