SecReT4
Protein ID: 154244540
T4SS name [ID]Trb [272]
Gene symbol-
Locus tagXaut_0585
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]655257..655802 [+]
Productconjugal transfer protein
Component typeTraF
UniProt IDA7ICU8
KEGG IDxau:Xaut_0585
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 2.1e-53, Aligned region: 29..166
Protein Sequence: 181 a.a.     [Download]
>gi|154244540|ref|YP_001415498.1| conjugal transfer protein [Xanthobacter autotrophicus Py2]
MTRFGTVMVTYFSVMGVAAASFVPTPLKLVWNVSASAPIGLYAIEPARRLEVTDLLAITPPAALDRFLVA
RGYVGAGVPLMKRVAALPGQEVCRTNRTITVDGVAYGEAVERDRMGRPLPVWRGCRRIAAGELFLMNFNV
PDSLDGRYFGPLPASTVIGHAVPLYTDEAGDGHFVWRAPTR
 
Nucleotide Sequence: 546 bp     [Download]
>gi|154243958|ref|NC_009720.1|:655257-655802 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGACCCGCTTCGGCACTGTGATGGTGACGTATTTCTCCGTGATGGGGGTCGCGGCGGCCTCCTTCGTTC
CGACACCGCTGAAGCTGGTGTGGAACGTCTCCGCCAGCGCACCCATCGGGCTCTATGCCATCGAGCCGGC
GCGCAGGCTCGAGGTCACGGATCTCCTCGCCATTACGCCCCCGGCGGCACTCGACCGCTTCCTGGTGGCG
CGCGGCTATGTGGGGGCTGGTGTGCCGCTGATGAAGCGCGTGGCGGCGCTTCCCGGCCAGGAGGTCTGCC
GCACAAACCGCACCATCACGGTCGATGGCGTCGCCTATGGCGAAGCGGTGGAGCGCGACCGCATGGGACG
ACCCCTACCAGTCTGGCGCGGCTGCCGGCGCATCGCCGCAGGCGAGCTCTTCCTCATGAATTTCAACGTG
CCCGACAGCCTCGACGGACGCTACTTCGGGCCGCTGCCGGCCAGCACCGTGATCGGCCACGCTGTGCCGC
TCTACACCGATGAGGCCGGAGACGGACACTTCGTCTGGCGCGCACCGACGCGCTGA
 Primer design