SecReT4
Protein ID: 154244541
T4SS name [ID]Trb [272]
Gene symbol-
Locus tagXaut_0586
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]655844..656629 [+]
Productlytic transglycosylase catalytic
Component typeTrbN
UniProt IDA7ICU9
KEGG IDxau:Xaut_0586
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 261 a.a.     [Download]
>gi|154244541|ref|YP_001415499.1| lytic transglycosylase catalytic [Xanthobacter autotrophicus Py2]
MLQADLFLRVRPPTDKSKRARAHRGAIVFILLSGMPFGWASAALSAEASATHKLPVPSEPYADLIAEAAE
RFDIPSVWIRSVMRAESDGAARATSPKGAMGLMQIMPETWAELRIHYGLGDDPYDPYDNIMAGAAHLREL
FDRYGNPGFLAAYNAGAGRYDAARKERPLPVETRAYVDKLASDIAHRETEHDARKLSAPPAVEAASWARS
SIFAVPPIRVPAADPVSPDRAQPVPDVRDVSAIVPQSDGLFVARGGTGGTP
 
Nucleotide Sequence: 786 bp     [Download]
>gi|154243958|ref|NC_009720.1|:655844-656629 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGCTGCAGGCGGATTTGTTCCTGCGTGTCCGTCCCCCGACGGACAAATCAAAAAGAGCGCGCGCCCACC
GCGGCGCGATCGTCTTTATTCTCCTTTCCGGAATGCCTTTCGGCTGGGCGAGTGCTGCCCTGTCGGCAGA
GGCTTCGGCAACACACAAGCTGCCGGTACCGAGCGAACCCTACGCGGATCTCATCGCGGAAGCGGCGGAG
CGCTTCGACATTCCCTCCGTCTGGATCCGAAGCGTGATGCGCGCGGAAAGCGATGGCGCTGCGCGCGCGA
CATCGCCGAAGGGCGCCATGGGGCTGATGCAGATCATGCCCGAGACCTGGGCCGAACTGCGCATTCATTA
CGGCCTCGGCGACGATCCCTATGACCCGTACGACAACATAATGGCCGGTGCGGCTCATCTGCGGGAGCTG
TTCGACCGCTACGGCAACCCCGGCTTCCTCGCCGCCTACAATGCCGGGGCAGGACGCTATGATGCAGCTC
GGAAGGAGCGACCCCTGCCGGTGGAGACGCGCGCCTATGTCGACAAGCTGGCGTCGGACATCGCGCACCG
TGAAACCGAGCACGACGCGCGGAAGCTGTCCGCTCCTCCGGCGGTCGAAGCGGCATCCTGGGCCCGGTCT
TCGATCTTCGCCGTGCCGCCGATCCGGGTGCCGGCTGCCGATCCGGTGTCACCCGATCGTGCACAGCCGG
TGCCTGACGTGCGCGATGTCTCAGCCATCGTTCCGCAGTCTGATGGGCTGTTCGTCGCTCGCGGCGGCAC
GGGAGGCACGCCATGA
 Primer design