SecReT4
Protein ID: 154244544
T4SS name [ID]Trb [272]
Gene symbol-
Locus tagXaut_0589
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]660227..662206 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA7ICV2
KEGG IDxau:Xaut_0589
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.1e-101, Aligned region: 111..557
TraG-D_C [PF12696], Evalue: 8.3e-31, Aligned region: 401..522
TrwB_AAD_bind [PF10412], Evalue: 3.9e-29, Aligned region: 171..536
AAA_10 [PF12846], Evalue: 3.6e-05, Aligned region: 368..478
Protein Sequence: 659 a.a.     [Download]
>gi|154244544|ref|YP_001415502.1| conjugal transfer coupling protein TraG [Xanthobacter autotrophicus Py2]
MSATKILWGQILLVLAIVLATTWGATQVVAWRLGFQDQLGPPWFLMGPWAVYPPPAFFWWWYFYDAYAPA
IFVEGAIIAASGGFLSIAAAIGLSVWRAREAKRVETYGSARWAEPDEIRSAGLLGPDGVVLGRHGRDYLR
HDGPEHVLCFAPTRSGKGVGLVVPSLLTWPGSAIVHDIKGENWQLTAGFRARHGRVLLFDPTNVRSSAYN
PLLEVRRGEWEVRDVQNIADILVDPEGSLEKRNHWEKTSHALLVGAILHVLYAERDKTLAGVAAFLSDPR
RPIETTLAAMMTTAHLGEAGPHPVIASAARELLNKSENERSGVLSTAMSFLGLYRDPVVAEVTRCCDWRI
TDLVAGARPTTLYLVVPPSDINRTKPLIRLILNQVGRRLTEDLQAKAGRHRLLLMLDEFPALGRLDFFES
ALAFMAGYGLKSFLIAQSLNQIEKAYGPNNSILDNCHVRVSFATNDERTAKRVSDALGTATEMKAMKNYA
GHRLSPWLGHLMVSRSETARPLLTPGEVMQLPPADEIVMVAGTPPIRAKKARYYEDERFRERVLHPPELS
APCDRQTDDWTVLPLPAPSQLSLMVEESDDEDTTGSEQRRQPELARVETVETSQQVRNEFEIDLVDETED
DVARTSRMTGVMQGVARQVSLDPNDGMEL
 
Nucleotide Sequence: 1980 bp     [Download]
>gi|154243958|ref|NC_009720.1|:660227-662206 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGTCCGCGACCAAGATCCTTTGGGGCCAGATCCTCCTTGTCCTCGCCATCGTGCTCGCCACCACCTGGG
GCGCCACGCAGGTCGTGGCCTGGCGGCTGGGCTTCCAGGACCAACTGGGACCGCCCTGGTTCCTGATGGG
GCCCTGGGCCGTCTACCCTCCGCCCGCTTTCTTCTGGTGGTGGTATTTTTACGACGCCTATGCGCCGGCC
ATCTTCGTTGAGGGGGCGATCATCGCCGCCTCGGGTGGGTTCCTGTCCATCGCCGCCGCCATCGGGCTTT
CGGTGTGGCGGGCGCGGGAAGCGAAGCGCGTCGAGACCTATGGCTCCGCCCGCTGGGCCGAGCCGGACGA
GATCCGGTCAGCCGGACTGCTCGGGCCCGATGGCGTGGTGCTGGGGCGCCATGGTCGGGACTATCTGCGC
CATGACGGACCGGAGCACGTTTTGTGCTTCGCACCGACCCGGTCGGGCAAGGGCGTCGGCCTCGTCGTAC
CCTCGCTGCTCACCTGGCCCGGCTCGGCCATCGTCCACGACATCAAGGGCGAGAACTGGCAGCTCACCGC
AGGCTTCCGGGCGCGGCACGGGCGGGTGTTGCTGTTCGACCCCACCAATGTGCGGTCCTCCGCCTACAAT
CCCCTGCTGGAGGTCCGCCGCGGGGAATGGGAGGTGCGGGACGTCCAGAACATTGCCGACATCCTGGTGG
ACCCGGAAGGCTCCCTGGAAAAGCGCAACCACTGGGAGAAGACCAGCCACGCCCTCCTCGTGGGCGCCAT
CCTCCATGTGCTCTATGCCGAGCGGGACAAGACCCTGGCCGGTGTCGCCGCCTTCCTCTCCGATCCCCGG
CGGCCCATCGAGACGACGCTCGCGGCCATGATGACGACGGCGCACCTCGGGGAGGCGGGTCCCCATCCGG
TGATCGCCAGCGCCGCCCGCGAGCTGCTCAACAAGTCCGAGAACGAGCGGTCCGGCGTGCTCTCCACCGC
CATGTCCTTCCTCGGGCTTTATCGTGATCCCGTGGTCGCGGAGGTGACCCGATGCTGCGACTGGCGTATC
ACCGACCTTGTGGCAGGTGCCCGGCCGACCACACTCTACCTCGTCGTGCCGCCGTCTGACATCAACCGGA
CCAAGCCGCTTATTCGGCTGATCCTGAACCAGGTTGGTCGCCGCCTCACTGAGGACCTGCAGGCGAAGGC
CGGTCGCCACCGGCTTCTCCTGATGCTGGACGAGTTCCCCGCGCTCGGGCGGCTCGACTTCTTCGAGAGC
GCGCTCGCCTTCATGGCGGGCTACGGGCTGAAGAGCTTCCTCATCGCCCAATCTCTGAACCAGATCGAGA
AGGCCTACGGGCCGAACAACTCCATCCTCGACAACTGCCATGTGCGGGTGAGCTTCGCCACCAATGACGA
GCGCACCGCCAAGCGCGTCTCCGATGCCCTCGGCACTGCCACCGAAATGAAGGCCATGAAGAACTATGCT
GGCCACCGACTCTCCCCCTGGCTTGGTCACCTCATGGTCTCCCGCTCGGAGACAGCCCGTCCGCTTCTGA
CGCCGGGCGAAGTGATGCAGCTTCCGCCCGCCGACGAGATCGTCATGGTGGCCGGCACGCCGCCGATCCG
GGCGAAGAAGGCGCGCTACTATGAGGATGAGCGGTTCAGGGAGCGGGTACTGCATCCGCCGGAGCTCTCG
GCTCCTTGCGATCGCCAGACCGACGACTGGACGGTACTTCCGTTGCCCGCGCCATCGCAACTGAGCCTGA
TGGTCGAGGAAAGTGACGATGAGGACACAACCGGCTCGGAGCAACGGCGCCAGCCGGAGCTTGCACGAGT
AGAGACGGTGGAGACGTCGCAGCAAGTGCGGAACGAGTTCGAGATCGATCTGGTCGATGAGACTGAAGAC
GACGTGGCCCGGACCAGTCGCATGACGGGCGTCATGCAGGGCGTCGCGCGTCAGGTCTCGCTCGATCCCA
ATGATGGCATGGAGCTGTGA
 Primer design