SecReT4
Protein ID: 154244550
T4SS name [ID]Trb [272]
Gene symbol-
Locus tagXaut_0595
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]669253..670239 [+]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDA7ICV8
KEGG IDxau:Xaut_0595
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.5e-85, Aligned region: 25..290
Protein Sequence: 328 a.a.     [Download]
>gi|154244550|ref|YP_001415508.1| P-type conjugative transfer ATPase TrbB [Xanthobacter autotrophicus Py2]
MAGSVHNPEGLTRGVRMLRTALGPVISRLLDEPAVVEVMLNPDGRLWVDRLSEGLSSTGERLAAGDGERI
IRLVAHHIGAEVHAGAPRLSAELPGTGERFEGLLPPVVAAPTFAIRKPAVAVFTLDDYVASGIMLAAQAD
ALREGVASRANILVAGGTSTGKTTLTNALLAEITKTSERVILIEDTRELQCAAPNLVALRTKDGIASLSN
LVRSSLRLRPDRIPIGEVRGAEALDLLKAWGTGHPGGISTIHAGSAMGALRRLEQLIQEAVVTVPRALIA
ETIDLIAVLSGRGTARRLTELARVEGLGPDGDYRISPAVPPAEEGTSP
 
Nucleotide Sequence: 987 bp     [Download]
>gi|154243958|ref|NC_009720.1|:669253-670239 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGGCGGGTTCAGTTCACAATCCGGAGGGCCTGACGCGCGGCGTACGTATGTTGCGCACCGCGCTCGGCC
CGGTGATTTCCCGCCTTCTCGATGAGCCGGCCGTCGTCGAGGTCATGCTCAACCCCGATGGCCGCCTCTG
GGTCGACCGGCTGTCCGAAGGCCTCTCAAGCACGGGCGAGCGGCTGGCGGCTGGAGACGGCGAGCGGATC
ATCCGCCTCGTCGCGCACCATATCGGCGCCGAGGTCCATGCCGGTGCCCCGCGGCTCTCCGCCGAGCTTC
CTGGGACCGGTGAGCGCTTCGAAGGTCTTCTCCCGCCCGTCGTCGCAGCTCCGACCTTTGCGATCCGCAA
GCCCGCCGTCGCGGTGTTCACGCTCGACGACTATGTGGCCTCGGGCATCATGTTGGCAGCGCAGGCCGAC
GCCCTGCGCGAGGGCGTCGCTTCCCGCGCCAACATTCTGGTGGCCGGCGGCACCTCCACCGGCAAGACCA
CCCTCACCAATGCCCTCCTCGCCGAAATCACTAAGACCTCCGAGCGGGTCATCCTGATCGAGGACACCCG
CGAGCTCCAGTGCGCCGCGCCCAATCTCGTGGCCTTGCGCACCAAGGACGGCATCGCCTCGCTCTCAAAC
CTCGTACGTTCTTCGCTCCGCCTGCGGCCCGACCGCATCCCGATCGGCGAGGTGCGCGGCGCGGAGGCCC
TTGACCTCCTGAAAGCGTGGGGGACGGGCCACCCTGGCGGCATCAGCACCATCCACGCCGGCAGCGCCAT
GGGCGCCCTGCGACGCCTGGAGCAGCTCATCCAGGAAGCCGTCGTCACCGTCCCACGCGCTCTGATCGCC
GAGACCATCGACCTGATCGCTGTGCTCTCCGGTCGTGGCACCGCCCGCCGGCTAACCGAACTCGCCCGCG
TCGAAGGCCTCGGTCCCGACGGCGACTACCGGATCTCTCCCGCTGTCCCTCCTGCTGAAGAAGGAACCTC
CCCGTGA
 Primer design