SecReT4
Protein ID: 154244551
T4SS name [ID]Trb [272]
Gene symbol-
Locus tagXaut_0596
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]670236..670568 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA7ICV9
KEGG IDxau:Xaut_0596
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.3e-25, Aligned region: 9..100
Protein Sequence: 110 a.a.     [Download]
>gi|154244551|ref|YP_001415509.1| conjugal transfer protein TrbC [Xanthobacter autotrophicus Py2]
MTPNRVSFDRRLLRTAAAIAAFACAVSAAHASGSSMPWETPLQSILESIQGPVAKIIAVIVIISTGLALA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFSGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|154243958|ref|NC_009720.1|:670236-670568 Xanthobacter autotrophicus Py2 chromosome, complete genome
GTGACTCCGAACCGCGTTTCCTTTGATCGCCGCCTGCTGCGAACCGCTGCTGCAATCGCCGCCTTCGCCT
GCGCTGTGTCTGCCGCCCACGCCTCCGGCTCCTCCATGCCCTGGGAGACGCCGCTGCAGTCCATCCTGGA
GTCCATCCAGGGGCCCGTCGCCAAGATCATCGCGGTGATCGTCATCATCTCGACCGGCCTCGCGCTCGCC
TTCGGCGACACGTCGGGTGGGTTCCGGCGGCTGATCCAGATCGTGTTCGGCCTCTCCATCGCCTTCGCCG
CCTCCAGCTTCTTCCTCTCCTTCTTCTCCTTCAGCGGCGGAGCGCTGGTCTGA
 Primer design