SecReT4
Protein ID: 154244552
T4SS name [ID]Trb [272]
Gene symbol-
Locus tagXaut_0597
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]670568..670840 [+]
Productconjugal transfer protein TrbB
Component typeTrbD
UniProt IDA7ICW0
KEGG IDxau:Xaut_0597
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.2e-09, Aligned region: 13..83
Protein Sequence: 90 a.a.     [Download]
>gi|154244552|ref|YP_001415510.1| conjugal transfer protein TrbB [Xanthobacter autotrophicus Py2]
MAGDAGEVPGFSVPIHRVLSEPILLGGAPRALAIFNGTLAGAVGLGLRLWLVGLALWAIGHLTAVWAAKR
DPLFVDVVRRHLRISSHLSV
 
Nucleotide Sequence: 273 bp     [Download]
>gi|154243958|ref|NC_009720.1|:670568-670840 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGGCGGGCGATGCCGGCGAGGTGCCGGGCTTCTCCGTCCCGATCCATCGGGTTCTGAGCGAACCGATCC
TGCTCGGCGGGGCGCCGCGGGCGCTCGCCATCTTCAACGGCACGCTCGCCGGTGCTGTCGGGCTGGGCCT
GAGGCTGTGGCTCGTGGGCCTGGCGCTCTGGGCGATTGGTCATCTCACCGCCGTCTGGGCGGCCAAGCGC
GATCCGCTCTTCGTCGACGTGGTGCGTCGGCATCTGCGCATCTCCTCCCACCTATCGGTCTGA
 Primer design