SecReT4
Protein ID: 154244553
T4SS name [ID]Trb [272]
Gene symbol-
Locus tagXaut_0598
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]670853..673282 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA7ICW1
KEGG IDxau:Xaut_0598
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3.6e-34, Aligned region: 442..720
CagE_TrbE_VirB [PF03135], Evalue: 4.2e-12, Aligned region: 181..388
Protein Sequence: 809 a.a.     [Download]
>gi|154244553|ref|YP_001415511.1| conjugal transfer ATPase TrbE [Xanthobacter autotrophicus Py2]
MMNLAEYRRHGSRLADYLPWAALVGPGLVLNKDGSFQRTACFRGPDLESAVPAELVAVAGRLNSTFRRLG
SGWALFVEAQRHEAGAYPESLFPDPASALVDAERKAGFAEAGSHFESSYFLTFCWLPPAEDAARAESWLY
EGRGREGVDPHEALDGFADRTDRVLRLVESFMPECHWLDDAETLTYLHGCVSIRRQRVRVPETPMYLDAL
LADQPLTGGLEPMLGDQHLRVLTIVGFPTATTPGILDDLNRLAFPYRWSTRAILLDKTDATRLLTKIRRQ
WFAKRKSIAAILKEVMTNEASVLVDSDADNKAEDADLALQELGADHAGIAYITAMVTVWDADPRVADEKL
RLVEKVIQGRDFTAMAETINAVDAWLGSLPGHVYANVRQPPVSTLNLAHMIPLSAVWAGDAQDAHFAAPP
LFYGKTEGSTPFRFTLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYAGSQVFAFDFGGSIRAAALAMG
GDWHDLGGSLAEESIALQPLSRVDELPERTWAADWIVTILTREGLSVTPEVKEHVWSALTSLASAPVDER
TLTGLAVLLQSNALKQALRPYCIGGAHGQLLDAEAEHLGQASVQAFETEGLIGTSAAPAVLSYLFHRIED
RLDGSPTLLIIDEGWLALDDPGFAGQLREWLKTLRKKNASVVFATQSLSDIDGSAIAPAIIESCQTRLLL
PNERAIEPQITAIYRRFGLNDRKIEILARATPKRDYYCQSRRGNRLFELGLSQVALALCAAGSKTDQAAL
SQILAEHGRDGFFAPWLRHRGLGWAADLILTLDNLEPRS
 
Nucleotide Sequence: 2430 bp     [Download]
>gi|154243958|ref|NC_009720.1|:670853-673282 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGATGAACCTCGCCGAGTATCGCCGACACGGGAGCCGGCTCGCGGACTATTTGCCGTGGGCGGCCCTGG
TCGGTCCTGGCCTCGTCCTCAACAAGGATGGCAGCTTCCAGCGCACCGCGTGCTTCCGTGGGCCAGACCT
CGAATCCGCGGTGCCAGCTGAGCTGGTGGCGGTGGCGGGTCGCCTCAACAGCACCTTCCGCCGCCTCGGC
TCCGGCTGGGCACTGTTCGTGGAAGCCCAGCGGCACGAGGCGGGAGCCTATCCCGAGAGCCTGTTTCCCG
ATCCTGCTTCCGCGTTGGTGGATGCCGAGCGGAAGGCCGGGTTCGCCGAGGCGGGCAGTCATTTCGAGTC
GAGCTATTTCCTCACCTTCTGTTGGCTCCCCCCAGCGGAGGATGCCGCACGGGCGGAGAGCTGGCTCTAT
GAGGGGCGTGGGCGCGAGGGTGTCGATCCTCATGAAGCATTGGATGGCTTCGCCGATCGGACAGACCGGG
TGCTTCGGCTGGTCGAGAGCTTCATGCCGGAGTGCCACTGGCTCGATGACGCCGAGACCCTGACCTATCT
CCACGGCTGCGTCTCGATCCGGCGCCAGCGGGTCCGTGTCCCCGAGACGCCCATGTATCTCGATGCGCTC
CTCGCCGACCAGCCGCTCACCGGCGGGCTGGAGCCGATGCTCGGGGACCAGCACCTGCGCGTGCTGACCA
TCGTGGGCTTTCCCACGGCAACGACGCCGGGGATCCTCGACGATCTCAACCGGCTGGCGTTTCCCTATCG
CTGGTCGACCCGCGCCATCCTCCTCGACAAGACCGACGCCACCCGGCTCCTCACGAAGATCCGCCGGCAG
TGGTTCGCCAAGCGCAAGTCCATTGCCGCCATCCTCAAGGAGGTGATGACCAACGAAGCTTCGGTGCTGG
TGGATTCGGATGCCGACAACAAGGCGGAGGACGCCGACCTCGCCTTGCAGGAGCTCGGCGCCGACCATGC
CGGCATCGCCTATATCACCGCCATGGTGACAGTCTGGGACGCCGATCCCCGCGTCGCCGACGAGAAGCTC
CGGCTGGTGGAGAAGGTGATCCAGGGCCGGGACTTCACCGCCATGGCGGAGACCATCAATGCAGTGGATG
CCTGGCTGGGCAGCCTGCCCGGGCACGTCTACGCCAATGTCCGCCAGCCTCCCGTCTCCACCCTGAACCT
CGCGCACATGATCCCGCTCTCCGCGGTCTGGGCGGGCGATGCGCAGGACGCGCATTTTGCGGCGCCGCCC
TTGTTCTACGGCAAGACGGAAGGCTCGACCCCGTTCCGCTTCACGCTCCACGTGGGGGATGTGGGGCACA
CGCTGGTGGTGGGGCCGACCGGTGCTGGCAAGTCCGTGCTGCTGGCGCTCATGGCCTTGCAGTTCCGGCG
CTATGCCGGCTCGCAGGTGTTCGCCTTCGATTTCGGCGGCAGCATCCGGGCGGCGGCCCTCGCCATGGGT
GGCGACTGGCACGATCTGGGCGGAAGCCTCGCCGAGGAGAGCATCGCGCTCCAGCCGCTTTCCCGTGTGG
ACGAACTGCCCGAGCGGACATGGGCTGCCGACTGGATCGTAACGATCCTGACCCGCGAAGGCCTCTCGGT
TACGCCGGAGGTGAAGGAGCATGTCTGGTCAGCGCTCACCTCGCTGGCCTCGGCCCCGGTAGACGAGCGC
ACCCTGACCGGTCTCGCTGTCCTCCTCCAGTCTAATGCCCTCAAGCAGGCCCTGCGGCCCTATTGCATCG
GTGGCGCCCATGGCCAGCTGCTCGACGCCGAGGCCGAGCATCTGGGGCAGGCGTCCGTCCAGGCCTTTGA
GACCGAGGGGCTGATCGGCACTAGCGCCGCGCCGGCGGTGTTGTCCTATCTGTTCCACCGCATCGAGGAC
CGGCTCGACGGATCGCCGACCCTCCTCATCATCGACGAGGGATGGCTCGCCCTTGATGACCCGGGCTTCG
CCGGACAGCTCCGGGAATGGCTCAAGACCCTGCGTAAGAAGAACGCCAGCGTGGTGTTCGCCACCCAGTC
CCTCTCGGACATCGACGGCTCCGCCATCGCCCCCGCCATCATCGAGAGCTGCCAGACGCGGCTACTGCTC
CCCAACGAGCGGGCCATCGAGCCCCAGATCACCGCTATCTACCGGCGCTTCGGCCTCAACGACCGGAAGA
TCGAGATCCTCGCACGGGCCACCCCGAAGCGGGACTATTACTGCCAGTCCCGACGCGGCAACCGCCTGTT
CGAGCTCGGGCTCTCGCAGGTGGCGCTCGCCTTGTGCGCCGCCGGGTCCAAGACCGATCAGGCTGCGCTC
TCGCAGATCCTCGCCGAGCATGGGCGCGACGGCTTCTTCGCCCCCTGGCTGCGGCATCGCGGCCTCGGCT
GGGCCGCCGATCTCATCCTCACCCTCGACAATCTGGAGCCACGCTCATGA
 Primer design