SecReT4
Protein ID: 154244554
T4SS name [ID]Trb [272]
Gene symbol-
Locus tagXaut_0599
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]673279..674013 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA7ICW2
KEGG IDxau:Xaut_0599
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 2.4e-07, Aligned region: 10..46
Protein Sequence: 244 a.a.     [Download]
>gi|154244554|ref|YP_001415512.1| conjugal transfer protein TrbJ [Xanthobacter autotrophicus Py2]
MIRRSLRAVLVAAPLLFCPFAPAVAQYVVYDPSNYAQNVLQAARALQQVTNQITSLQNEAQMLINQTRNL
ANLPYSSISAFQQAAQRTQQLLGQAQKIAYDVTAIDRAFQGQYGSVSLSSSDAALVTQAKSRWETTVAGL
QDALRVQAGVVGNLDTGRSQASTLVGQSQAASGALQAMQAGNQLQALQAQQLSDLTAVITANGRAQALSE
AERATAVSEGQERYRRFSTRSSYQPAAVTMFHGK
 
Nucleotide Sequence: 735 bp     [Download]
>gi|154243958|ref|NC_009720.1|:673279-674013 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGATCCGCCGTTCATTGCGGGCGGTGCTCGTCGCCGCGCCGCTTCTTTTCTGCCCGTTCGCGCCGGCCG
TGGCGCAGTACGTGGTCTACGACCCCTCCAACTATGCCCAGAACGTCCTTCAAGCTGCTCGGGCGCTACA
GCAGGTCACCAACCAGATCACCTCGCTTCAGAACGAAGCGCAGATGCTGATCAATCAGACCCGCAATCTT
GCGAACCTGCCTTATTCCTCTATCAGCGCATTCCAGCAGGCGGCCCAGCGCACCCAGCAATTGCTCGGTC
AGGCCCAGAAGATCGCCTATGACGTCACCGCCATCGACCGGGCGTTTCAGGGCCAGTATGGCTCGGTCTC
CCTGAGCAGTTCGGATGCCGCCCTTGTCACCCAGGCGAAGAGCCGCTGGGAGACCACGGTCGCCGGCCTC
CAGGATGCGCTGCGGGTGCAGGCGGGCGTCGTCGGCAATCTCGACACCGGCCGCTCGCAGGCCTCGACAC
TGGTCGGCCAGAGCCAGGCGGCGAGCGGCGCGCTGCAGGCCATGCAGGCGGGCAACCAGCTTCAGGCGCT
CCAGGCCCAGCAGCTCTCCGACCTCACCGCCGTGATCACGGCGAACGGCCGCGCACAGGCCCTGTCCGAA
GCTGAGCGGGCGACGGCGGTGTCGGAAGGGCAGGAGCGCTACCGGCGCTTCTCCACCCGGTCGAGCTACC
AGCCTGCCGCCGTCACCATGTTCCACGGCAAGTGA
 Primer design