SecReT4
Protein ID: 154244556
T4SS name [ID]Trb [272]
Gene symbol-
Locus tagXaut_0601
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]674280..675503 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA7ICW4
KEGG IDxau:Xaut_0601
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.3e-52, Aligned region: 37..262
Protein Sequence: 407 a.a.     [Download]
>gi|154244556|ref|YP_001415514.1| conjugal transfer protein TrbL [Xanthobacter autotrophicus Py2]
MNDVGVIDTFLNTFTSYIDSGFGLIKGEVTGLSSLLIALDITLAGLFWAWGADEDVMRRLVRKTLAIGFF
AWIIGNFNALAKIVFESFAGLGLKAGGSTISTAEFLRPGRLAEVGLTAGQPLLDAASQLTGPVALFVNAV
QIAVLLVSWLLILIAFFILAVQLFVTLIEFKLTTLAGFVLIPFAFFGKTAFLAEKVLGNIVASGVKVMVL
AVIVGIGSGLFSQFTTSYGDAQPTISQALSAVLAALALLGLGIFGPGIATGLLTGAPQLGAGAAVGTGLA
AGGVALAGAGATGLTVRGAAAALAGTAAAARAGVSLAGGAASAYSAGAAGQSGGAGVAGGLGVVARAGAA
ATASSAPASSGDVPDWAQRMRRSQQVAHGIQTATHAVRSGDSHGGGSSISLSESDRP
 
Nucleotide Sequence: 1224 bp     [Download]
>gi|154243958|ref|NC_009720.1|:674280-675503 Xanthobacter autotrophicus Py2 chromosome, complete genome
GTGAACGACGTGGGCGTCATCGACACCTTCCTCAACACCTTCACCAGCTACATCGATTCCGGCTTCGGCC
TGATCAAGGGCGAGGTGACGGGCCTCTCCTCCCTCCTGATCGCTCTCGACATCACGCTTGCCGGCCTGTT
CTGGGCCTGGGGCGCCGACGAGGACGTGATGCGCCGGCTGGTGAGGAAGACGCTGGCCATCGGCTTCTTC
GCCTGGATCATCGGCAACTTCAACGCGCTCGCCAAGATCGTATTCGAGAGCTTCGCTGGCCTCGGCCTCA
AGGCCGGCGGGTCGACCATCAGCACGGCGGAGTTCCTGCGGCCGGGGCGCCTTGCAGAAGTCGGGCTCAC
CGCGGGCCAGCCGCTGCTCGATGCGGCGAGCCAGCTCACCGGGCCGGTAGCGCTCTTCGTCAATGCCGTG
CAGATCGCCGTGCTGCTGGTCTCCTGGCTCCTGATCCTGATCGCCTTCTTCATCCTGGCGGTGCAGCTCT
TCGTCACCCTCATCGAGTTCAAGCTGACGACGCTCGCCGGCTTTGTGCTCATCCCCTTCGCTTTCTTCGG
CAAGACCGCCTTCCTCGCCGAGAAGGTGCTCGGCAACATCGTCGCGTCGGGCGTCAAGGTGATGGTCCTT
GCCGTCATCGTCGGCATCGGCTCAGGGCTGTTCTCGCAATTCACCACCTCCTATGGCGATGCCCAGCCGA
CCATCAGCCAGGCCCTGTCCGCCGTGCTGGCGGCCCTGGCGCTCCTCGGCCTCGGTATCTTCGGGCCGGG
GATCGCCACGGGACTGCTTACCGGTGCGCCACAGCTGGGTGCAGGCGCCGCCGTCGGGACCGGCCTTGCT
GCGGGAGGTGTTGCGCTCGCGGGCGCCGGCGCCACTGGCCTCACGGTACGTGGGGCAGCTGCTGCGCTCG
CCGGAACAGCCGCTGCGGCTCGTGCTGGCGTGAGCCTCGCCGGAGGAGCCGCATCCGCGTACAGCGCGGG
AGCTGCCGGCCAATCCGGGGGGGCTGGCGTCGCGGGTGGACTTGGTGTTGTCGCGCGCGCCGGGGCCGCT
GCCACCGCGTCGAGCGCCCCGGCTTCTTCTGGTGATGTTCCCGACTGGGCCCAACGCATGCGGCGCTCCC
AGCAGGTCGCCCACGGCATCCAGACCGCGACCCACGCGGTGCGGTCCGGCGACAGCCATGGCGGCGGCTC
CTCCATCTCCCTCTCCGAAAGCGATCGTCCATGA
 Primer design