SecReT4
Protein ID: 154244557
T4SS name [ID]Trb [272]
Gene symbol-
Locus tagXaut_0602
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]675500..676189 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA7ICW5
KEGG IDxau:Xaut_0602
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4e-61, Aligned region: 23..226
Protein Sequence: 229 a.a.     [Download]
>gi|154244557|ref|YP_001415515.1| conjugal transfer protein TrbF [Xanthobacter autotrophicus Py2]
MTPFKRPAVHYGRAPEPETPYHRAAQVWDDRIGSARVQAKNWRLMAFGCLALSAGLSGALAWQALSGSVV
PWVVQVDKLGLAQAVAPASSDYRPSDPQIAFHLARFIEEVRSISADPVIVRQNWLRAYAYTTQAGAVALN
DYARANDPFARVGKQQVAVEVSSVIRASPDSFRIAWTERRYQDGSLADNARWSAILTVVVQAPRDAERLR
ANPLGIYVNAINWSKELAQ
 
Nucleotide Sequence: 690 bp     [Download]
>gi|154243958|ref|NC_009720.1|:675500-676189 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGACCCCGTTCAAGCGACCTGCGGTTCATTACGGCCGCGCACCCGAGCCCGAGACGCCGTATCATCGCG
CGGCCCAGGTCTGGGACGATCGCATCGGCTCGGCCCGCGTCCAGGCGAAGAACTGGCGCCTCATGGCGTT
CGGCTGCCTGGCGCTTTCGGCCGGCCTCTCCGGGGCCCTGGCCTGGCAGGCCCTGAGCGGCTCGGTGGTG
CCGTGGGTCGTCCAGGTGGACAAGCTGGGGCTGGCGCAGGCCGTGGCACCTGCATCGTCAGATTATCGCC
CCTCCGATCCCCAGATCGCCTTCCACCTCGCTCGCTTCATCGAGGAGGTGCGCAGCATCTCCGCCGATCC
CGTCATCGTCCGGCAGAACTGGCTCAGGGCCTATGCCTACACGACGCAAGCCGGAGCGGTTGCCCTCAAC
GACTATGCCCGGGCCAACGATCCCTTCGCCCGGGTCGGCAAGCAGCAGGTGGCGGTGGAGGTCTCGAGCG
TCATCCGTGCCTCGCCGGACTCCTTCCGCATCGCCTGGACCGAACGCCGCTACCAGGACGGCAGCCTCGC
CGACAACGCACGCTGGAGCGCCATCCTCACCGTCGTGGTGCAGGCGCCGCGGGACGCCGAGCGCCTCCGG
GCCAATCCCCTCGGGATCTACGTCAACGCCATCAACTGGTCGAAGGAGCTCGCACAATGA
 Primer design