SecReT4
Protein ID: 154244558
T4SS name [ID]Trb [272]
Gene symbol-
Locus tagXaut_0603
StrainXanthobacter autotrophicus Py2
Repliconchromosome [GenBank: NC_009720] [Browse all T4SS(s) in this replicon]
Location [Strand]676186..677238 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDA7ICW6
KEGG IDxau:Xaut_0603
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.3e-70, Aligned region: 119..343
Protein Sequence: 350 a.a.     [Download]
>gi|154244558|ref|YP_001415516.1| P-type conjugative transfer protein TrbG [Xanthobacter autotrophicus Py2]
MTPAIRTSGRPARRVLAFPALRKSGLPLLLICTSTLAGCATFEKPPEIEYDDAPPAVFKAEPPGPVRIVE
LPKPLPLPGQLKPVGKDGKAEPEAADPASRVNQANAAARVQPVRNGFINSMQVYPFVEGALYQVYAAPGQ
VTDIALQPGEQLVGTGPVAAGDTVRWIIGDTESGAGGAKQVHILVKPTRPDLITNLVINTNLRTYHMELR
STEKTYMASVSWQYPQDQLIALRRQNAEALAVQPVATGVDLTKVNFRYEVTGDRTPWRPLRAFDDGQQVF
IEFPRGIAQGEMPPLFVVGPQGDTSELVNYRVRGSYMIVDRLFAAAELRFGADKDQKRVRISRTNGRSVL
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|154243958|ref|NC_009720.1|:676186-677238 Xanthobacter autotrophicus Py2 chromosome, complete genome
ATGACACCGGCCATCCGCACATCCGGGAGGCCGGCGCGCCGTGTCCTCGCCTTTCCAGCTTTACGGAAAT
CTGGCTTGCCGCTTCTGCTCATTTGCACCTCCACGCTCGCTGGCTGCGCCACCTTCGAGAAGCCGCCGGA
GATCGAGTATGACGATGCACCGCCCGCCGTCTTCAAGGCCGAGCCGCCGGGGCCGGTGCGCATCGTCGAG
CTGCCGAAGCCTTTGCCGCTGCCGGGCCAGCTGAAGCCGGTGGGCAAGGACGGCAAAGCTGAGCCCGAAG
CCGCTGACCCTGCCTCTCGGGTGAACCAGGCCAATGCCGCAGCCCGGGTCCAGCCGGTGCGCAATGGCTT
CATCAACTCCATGCAGGTCTACCCCTTCGTGGAAGGCGCCCTCTATCAGGTCTATGCCGCGCCCGGGCAG
GTCACCGACATTGCGCTGCAGCCGGGTGAGCAACTGGTGGGCACGGGGCCCGTAGCCGCCGGCGACACGG
TGCGCTGGATCATCGGTGATACCGAGAGTGGGGCCGGCGGAGCGAAGCAGGTCCACATCCTGGTGAAGCC
CACGCGGCCCGACCTCATCACCAACCTCGTCATCAACACCAATCTGCGCACCTATCACATGGAGCTGCGC
TCTACCGAGAAGACCTACATGGCCTCGGTTTCCTGGCAGTACCCGCAGGACCAGCTCATCGCCTTGCGGC
GCCAGAATGCCGAGGCGCTGGCGGTGCAGCCGGTCGCCACAGGCGTCGACCTCACCAAGGTGAACTTCCG
CTATGAGGTGACCGGTGACCGGACGCCGTGGCGACCGCTGCGCGCCTTCGACGATGGCCAGCAGGTGTTC
ATCGAGTTCCCCAGGGGCATCGCCCAGGGCGAGATGCCGCCGCTCTTTGTCGTAGGCCCGCAGGGCGACA
CCTCCGAGCTTGTGAACTATCGCGTGCGCGGCAGCTACATGATCGTGGACCGGCTGTTCGCGGCGGCCGA
GCTGCGCTTCGGTGCCGACAAGGATCAGAAGCGCGTGCGCATCTCCCGCACCAACGGGAGGTCGGTCCTA
TGA
 Primer design